RegulonDB RegulonDB 10.9: Gene Form
   

insI2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insI2 pdxI insCD2 insC2 insD2 terminator anti-terminator anti-anti-terminator terminator anti-terminator anti-anti-terminator ydbDp ydbDp TSS_1799 (cluster) TSS_1799 (cluster) pdxIp1 pdxIp1 TSS_1798 TSS_1798 TSS_1797 TSS_1797 TSS_1796 TSS_1796 TSS_1795 TSS_1795 TSS_1794 TSS_1794 TSS_1793 (cluster) TSS_1793 (cluster)

Gene      
Name: insI2    Texpresso search in the literature
Synonym(s): ECK0258, G6725, b1404, tra8-2
Genome position(nucleotides): 1469358 --> 1470509 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.83
External database links:  
ASAP:
ABE-0004691
ECOLIHUB:
insI-2
OU-MICROARRAY:
b1404
STRING:
511145.b4284
COLOMBOS: insI2


Product      
Name: IS30 transposase
Synonym(s): InsI2, Tra8-2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.281
Isoelectric point: 11.477
Motif(s):
 
Type Positions Sequence
58 -> 98 HLTLSEREEIRAGLSAKMSIRAIATALNRSPSTISREVQRN
213 -> 379 VNGTPIHERSRNIDNRRSLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSPWQRGTNENTNGLIRQYFPKKTCLAQYTQHELDLVAAQLNNRPRKTLKFKTPKEIIERGV
230 -> 320 SLGHWEGDLVSGTKNSHIATLVDRKSRYTIILRLRGKDSVSVNQALTDKFLSLPSELRKSLTWDRGMELARHLEFTVSTGVKVYFCDPQSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Olasz F., et al., 1997
External database links:  
ECOCYC:
G6725-MONOMER
ECOLIWIKI:
b1404
INTERPRO:
IPR036397
INTERPRO:
IPR025246
INTERPRO:
IPR012337
INTERPRO:
IPR001584
INTERPRO:
IPR001598
MODBASE:
P0CF89
PFAM:
PF13936
PFAM:
PF00665
PRIDE:
P0CF89
PROSITE:
PS50994
PROSITE:
PS01043
REFSEQ:
NP_415922
UNIPROT:
P0CF89


Operon      
Name: insI2         
Operon arrangement:
Transcription unit        Promoter
insI2


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1793 (cluster) 1469178 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1794 1469343 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1795 1470141 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1796 1470761 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1797 1471321 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1798 1472340 forward nd [RS-EPT-CBR] [2]
  promoter pdxIp1 1474188 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_1799 (cluster) 1474189 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Olasz F., Farkas T., Stalder R., Arber W., 1997, Mutations in the carboxy-terminal part of IS30 transposase affect the formation and dissolution of (IS30)2 dimer., FEBS Lett 413(3):453-61

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB