RegulonDB RegulonDB 10.9: Gene Form
   

mnaT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

curA mnaT ydcZ ydcY TSS_1824 TSS_1824 yncBp4 yncBp4 TSS_1823 TSS_1823 TSS_1822 TSS_1822 TSS_1821 TSS_1821 TSS_1820 TSS_1820 TSS_1819 TSS_1819 ydcZp1 ydcZp1

Gene      
Name: mnaT    Texpresso search in the literature
Synonym(s): ECK1442, G6759, b1448, yncA
Genome position(nucleotides): 1518328 <-- 1518846 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.18
External database links:  
ASAP:
ABE-0004827
ECHOBASE:
EB3533
ECOLIHUB:
yncA
OU-MICROARRAY:
b1448
STRING:
511145.b1448
COLOMBOS: mnaT


Product      
Name: L-amino acid N-acyltransferase
Synonym(s): MnaT, YncA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.248
Isoelectric point: 6.3
Motif(s):
 
Type Positions Sequence
93 -> 98 GKGLGR
16 -> 136 EIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYPVLVSEENGVVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGF
85 -> 87 VYV
1 -> 163 MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYPVLVSEENGVVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
External database links:  
ECOCYC:
G6759-MONOMER
ECOLIWIKI:
b1448
INTERPRO:
IPR016181
INTERPRO:
IPR000182
MODBASE:
P76112
PFAM:
PF00583
PRIDE:
P76112
PROSITE:
PS51186
REFSEQ:
NP_415965
SMR:
P76112
SWISSMODEL:
P76112
UNIPROT:
P76112


Operon      
Name: mnaT-ydcZ         
Operon arrangement:
Transcription unit        Promoter
mnaT-ydcZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydcZp1 1518375 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1819 1518403 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1820 1518461 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1821 1518476 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1822 1518862 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1823 1518873 reverse nd [RS-EPT-CBR] [2]
  promoter yncBp4 1518892 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1824 1518999 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB