RegulonDB RegulonDB 10.9: Gene Form
   

yncH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhsE yncG ydcD yncH yncO TSS_1825 TSS_1825

Gene      
Name: yncH    Texpresso search in the literature
Synonym(s): ECK1449, G6766, b1455
Genome position(nucleotides): 1526940 --> 1527152 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
31.46
External database links:  
ASAP:
ABE-0004855
ECHOBASE:
EB3540
ECOLIHUB:
yncH
OU-MICROARRAY:
b1455
STRING:
511145.b1455
COLOMBOS: yncH


Product      
Name: DUF5445 domain-containing protein YncH
Synonym(s): YncH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.27
Isoelectric point: 9.253
Motif(s):
 
Type Positions Sequence
19 -> 70 ISSEKKLTIHIVQMFQLLSQAFYNLKMFLMMDMLGVGDAININTNKNIRQVC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12752N
ECOCYC:
G6766-MONOMER
ECOLIWIKI:
b1455
INTERPRO:
IPR020099
PFAM:
PF17520
PRIDE:
P76118
REFSEQ:
NP_415972
UNIPROT:
P76118


Operon      
Name: yncH         
Operon arrangement:
Transcription unit        Promoter
yncH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1825 1530150 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB