RegulonDB RegulonDB 10.9: Gene Form
   

lsrK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yneO lsrK lsrR hipB IHF HipB HipAB HipB HipAB HipB HipAB HipB HipAB anti-terminator terminator hipBp hipBp

Gene      
Name: lsrK    Texpresso search in the literature
Synonym(s): ECK1504, G6798, b1511, ydeV
Genome position(nucleotides): 1598617 <-- 1600209 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0005041
ECHOBASE:
EB3565
ECOLIHUB:
lsrK
OU-MICROARRAY:
b1511
STRING:
511145.b1511
COLOMBOS: lsrK


Product      
Name: autoinducer-2 kinase
Synonym(s): LsrK, YdeV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 57.545
Isoelectric point: 5.092
Motif(s):
 
Type Positions Sequence
13 -> 260 YLMALDAGTGSIRAVIFDLEGNQIAVGQAEWRHLAVPDVPGSMEFDLNKNWQLACECMRQALHNAGIAPEYIAAVSACSMREGIVLYNNEGAPIWACANVDARAAREVSELKELHNNTFENEVYRATGQTLALSAIPRLLWLAHHRSDIYRQASTITMISDWLAYMLSGELAVDPSNAGTTGLLDLTTRDWKPALLDMAGLRADILSPVKETGTLLGVVSSQAAELCGLKAGTPVVVGGGDVQLGCLG
298 -> 467 PHVIPGMVQAESISFFTGLTMRWFRDAFCAEEKLIAERLGIDTYTLLEEMASRVPPGSWGVMPIFSDRMRFKTWYHAAPSFINLSIDPDKCNKATLFRALEENAAIVSACNLQQIADFSNIHPSSLVFAGGGSKGKLWSQILADVSGLPVNIPVVKEATALGCAIAAGVG
490 -> 495 PDPEKH

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0071518 - autoinducer-2 kinase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0009372 - quorum sensing
GO:0016310 - phosphorylation
GO:0044010 - single-species biofilm formation
Note(s): Note(s): ...[more].
Reference(s): [1] Brito PH., et al., 2013
[2] Gamby S., et al., 2012
[3] Hooshangi S., et al., 2011
[4] Quan DN., et al., 2012
[5] Roy V., et al., 2010
[6] Zargar A., et al., 2015
External database links:  
DIP:
DIP-11687N
ECOCYC:
G6798-MONOMER
ECOLIWIKI:
b1511
INTERPRO:
IPR033676
INTERPRO:
IPR043129
INTERPRO:
IPR018485
INTERPRO:
IPR018484
INTERPRO:
IPR000577
MODBASE:
P77432
PDB:
5YA1
PDB:
5YA2
PDB:
5YA0
PFAM:
PF02782
PFAM:
PF00370
PRIDE:
P77432
PRODB:
PRO_000023133
PROSITE:
PS00933
REFSEQ:
NP_416028
SMR:
P77432
UNIPROT:
P77432


Operon      
Name: lsrRK         
Operon arrangement:
Transcription unit        Promoter
lsrRK
lsrK


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: LsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Brito PH., Rocha EP., Xavier KB., Gordo I., 2013, Natural genome diversity of AI-2 quorum sensing in Escherichia coli: conserved signal production but labile signal reception., Genome Biol Evol 5(1):16-30

 [2] Gamby S., Roy V., Guo M., Smith JA., Wang J., Stewart JE., Wang X., Bentley WE., Sintim HO., 2012, Altering the communication networks of multispecies microbial systems using a diverse toolbox of AI-2 analogues., ACS Chem Biol 7(6):1023-30

 [3] Hooshangi S., Bentley WE., 2011, LsrR quorum sensing "switch" is revealed by a bottom-up approach., PLoS Comput Biol 7(9):e1002172

 [4] Quan DN., Bentley WE., 2012, Gene network homology in prokaryotes using a similarity search approach: queries of quorum sensing signal transduction., PLoS Comput Biol 8(8):e1002637

 [5] Roy V., Smith JA., Wang J., Stewart JE., Bentley WE., Sintim HO., 2010, Synthetic analogs tailor native AI-2 signaling across bacterial species., J Am Chem Soc 132(32):11141-50

 [6] Zargar A., Quan DN., Emamian M., Tsao CY., Wu HC., Virgile CR., Bentley WE., 2015, Rational design of 'controller cells' to manipulate protein and phenotype expression., Metab Eng 30:61-8


RegulonDB