RegulonDB RegulonDB 11.0: Gene Form
   

ydfT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfU ydfT ynfS

Gene      
Name: ydfT    Texpresso search in the literature
Synonym(s): ECK1553, G6830, b1559, quuQ
Genome position(nucleotides): 1642489 <-- 1643241
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.94
External database links:  
ASAP:
ABE-0005207
ECHOBASE:
EB3593
ECOLIHUB:
ydfT
OU-MICROARRAY:
b1559
STRING:
511145.b1559
COLOMBOS: ydfT


Product      
Name: Qin prophage; putative antitermination protein Q
Synonym(s): QuuQ, YdfT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.926
Isoelectric point: 9.209
Motif(s):
 
Type Positions Sequence Comment
24 -> 107 TGTGCLTITDVMAAQGMVQSKAPLGLALFLAKVGVQDPQFAIEGLLNYAMALDNPTLNKLSEEIRLQIIPYLVSFAFADYSRSA
155 -> 242 GEASTACRGCKGKGIVLDEKRTRFHGVPVYKICGRCNGNRFSRLPTTLARRHVQKLVPDLTDYQWYKGYADVIGKLVTKCWQEEAYAE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P76161
DIP:
DIP-28061N
ECOCYC:
G6830-MONOMER
ECOLIWIKI:
b1559
INTERPRO:
IPR036410
INTERPRO:
IPR003222
PFAM:
PF03589
PRIDE:
P76161
PRODB:
PRO_000023672
REFSEQ:
NP_416077
SMR:
P76161
UNIPROT:
P76161


Operon      
Name: ydfUT         
Operon arrangement:
Transcription unit        Promoter
ydfUT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB