RegulonDB RegulonDB 10.9: Gene Form
   

rsxB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsxC rsxD rsxA rsxB ydgK terminator anti-terminator TSS_1909 TSS_1909 TSS_1908 TSS_1908 rsxAp rsxAp TSS_1907 TSS_1907 TSS_1906 TSS_1906

Gene      
Name: rsxB    Texpresso search in the literature
Synonym(s): ECK1624, G6872, b1628, ydgM
Genome position(nucleotides): 1706348 --> 1706926 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.58
External database links:  
ASAP:
ABE-0005452
ECHOBASE:
EB3693
ECOLIHUB:
rsxB
OU-MICROARRAY:
b1628
STRING:
511145.b1628
COLOMBOS: rsxB


Product      
Name: SoxR [2Fe-2S] reducing system protein RsxB
Synonym(s): RsxB, YdgM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.544
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
1 -> 26 MNAIWIAVAAVSLLGLAFGAILGYAS
110 -> 164 AVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISL
3 -> 25 AIWIAVAAVSLLGLAFGAILGYA
32 -> 91 EDDPVVEKIDEILPQSQCGQCGYPGCRPYAEAISCNGEKINRCAPGGEAVMLKIAELLNV
138 -> 167 AMHTVMSDLCTGCNLCVDPCPTHCISLQPV

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Koo MS., et al., 2003
External database links:  
ECOCYC:
G6872-MONOMER
ECOLIWIKI:
b1628
INTERPRO:
IPR017900
INTERPRO:
IPR007202
INTERPRO:
IPR010207
INTERPRO:
IPR016463
INTERPRO:
IPR017896
MODBASE:
P77223
PANTHER:
PTHR42859:SF3
PFAM:
PF14697
PFAM:
PF04060
PRIDE:
P77223
PRODB:
PRO_000023791
PROSITE:
PS51656
PROSITE:
PS00198
PROSITE:
PS51379
REFSEQ:
NP_416145
UNIPROT:
P77223


Operon      
Name: ydgK-rsxABCDGE-nth         
Operon arrangement:
Transcription unit        Promoter
ydgK-rsxABCDGE-nth
rsxABCDGE-nth


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1906 1705518 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1907 1705520 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1908 1706717 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1909 1708484 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Koo MS., Lee JH., Rah SY., Yeo WS., Lee JW., Lee KL., Koh YS., Kang SO., Roe JH., 2003, A reducing system of the superoxide sensor SoxR in Escherichia coli., EMBO J 22(11):2614-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB