RegulonDB RegulonDB 10.9: Gene Form
   

gstA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dtpA pdxY gstA terminator anti-terminator anti-anti-terminator gstAp gstAp TSS_1912 TSS_1912

Gene      
Name: gstA    Texpresso search in the literature
Synonym(s): ECK1631, G6878, b1635, gst
Genome position(nucleotides): 1714377 --> 1714982 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.5
External database links:  
ASAP:
ABE-0005473
ECHOBASE:
EB2497
ECOLIHUB:
gst
OU-MICROARRAY:
b1635
STRING:
511145.b1635
COLOMBOS: gstA


Product      
Name: glutathione S-transferase GstA
Synonym(s): Gst, GstA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.868
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
2 -> 74 KLFYKPGACSLASHITLRESGKDFTLVSVDLMKKRLENGDDYFAVNPKGQVPALLLDDGTLLTEGVAIMQYLA
87 -> 201 NSISRYKTIEWLNYIATELHKGFTPLFRPDTPEEYKPTVRAQLEKKLQYVNEALKDEHWICGQRFTIADAYLFTVLRWAYAVKLNLEGLEHIAAFMQRMAERPEVQDALSAEGLK
5 -> 5 Y
65 -> 66 EG
103 -> 106 TELH

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0004364 - glutathione transferase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0042542 - response to hydrogen peroxide
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9851N
ECOCYC:
GST-MONOMER
ECOLIWIKI:
b1635
INTERPRO:
IPR036249
INTERPRO:
IPR004045
INTERPRO:
IPR004046
INTERPRO:
IPR036282
INTERPRO:
IPR040079
INTERPRO:
IPR010987
MODBASE:
P0A9D2
PDB:
1N2A
PDB:
1A0F
PFAM:
PF02798
PFAM:
PF00043
PRIDE:
P0A9D2
PRODB:
PRO_000022850
PROSITE:
PS50405
PROSITE:
PS50404
REFSEQ:
NP_416152
SMR:
P0A9D2
UNIPROT:
P0A9D2


Operon      
Name: gstA         
Operon arrangement:
Transcription unit        Promoter
gstA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1912 1713632 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB