RegulonDB RegulonDB 10.9: Gene Form
   

nemA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: nemA    Texpresso search in the literature
Synonym(s): ECK1646, G6890, b1650, ydhN
Genome position(nucleotides): 1726659 --> 1727756 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.46
External database links:  
ASAP:
ABE-0005516
ECHOBASE:
EB3316
ECOLIHUB:
nemA
OU-MICROARRAY:
b1650
STRING:
511145.b1650
COLOMBOS: nemA


Product      
Name: N-ethylmaleimide reductase
Synonym(s): N-ethylmaleimide reductase, FMN-linked, NemA, YdhN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.516
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
324 -> 325 GR
5 -> 343 KLYSPLKVGAITAANRIFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLIISEATQISAQAKGYAGAPGIHSPEQIAAWKKITAGVHAENGHMAVQLWHTGRISHASLQPGGQAPVAPSALSAGTRTSLRDENGQAIRVETSMPRALELEEIPGIVNDFRQAIANAREAGFDLVELHSAHGYLLHQFLSPSSNHRTDQYGGSVENRARLVLEVVDAGIEEWGADRIGIRVSPIGTFQNTDNGPNEEADALYLIEQLGKRGIAYLHMSEPDWAGGEPYTDAFREKVRARFHGPIIGAGAYTVEKAETLIGKGLIDAVAFGRDWIANPDLVARLQRKAEL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0008748 - N-ethylmaleimide reductase activity
GO:0046857 - oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
GO:0010181 - FMN binding
GO:0034567 - chromate reductase activity
biological_process GO:0006805 - xenobiotic metabolic process
GO:0055114 - oxidation-reduction process
GO:0018937 - nitroglycerin metabolic process
GO:0046256 - 2,4,6-trinitrotoluene catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6890-MONOMER
ECOLIWIKI:
b1650
INTERPRO:
IPR001155
INTERPRO:
IPR013785
MODBASE:
P77258
PFAM:
PF00724
PRIDE:
P77258
PRODB:
PRO_000023369
REFSEQ:
NP_416167
SMR:
P77258
SWISSMODEL:
P77258
UNIPROT:
P77258


Operon      
Name: nemRA-gloA         
Operon arrangement:
Transcription unit        Promoter
nemRA
nemRA-gloA
gloA
nemA
ydhM


Transcriptional Regulation      
Display Regulation             
Repressed by: NemR, RutR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1929 1727798 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1930 1727800 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1931 1727809 forward nd [RS-EPT-CBR] [1]



RegulonDB