RegulonDB RegulonDB 10.8: Gene Form
   

ydhS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydhS ydhT ydhR ydhSp5 ydhSp5 TSS_1957 TSS_1957 ydhSp6 ydhSp6 ydhSp3 ydhSp3

Gene      
Name: ydhS    Texpresso search in the literature
Synonym(s): ECK1664, G6896, b1668
Genome position(nucleotides): 1747131 --> 1748735 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.85
External database links:  
ASAP:
ABE-0005575
ECHOBASE:
EB3711
OU-MICROARRAY:
b1668
PortEco:
ydhS
STRING:
511145.b1668
COLOMBOS: ydhS


Product      
Name: FAD/NAD(P) binding domain-containing protein YdhS
Synonym(s): YdhS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 60.755
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
5 -> 164 AIVGAGPTGIYTLFSLLQQQTPLSISIFEQADEAGVGMPYSDEENSKMMLANIASIEIPPIYCTYLEWLQKQEDSHLQRYGVKKETLHDRQFLPRILLGEYFRDQFLRLVDQARQQKFAVAVYESCQVTDLQITNAGVMLATNQDLPSETFDLAVIATGH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11738N
ECOCYC:
G6896-MONOMER
ECOLIWIKI:
b1668
INTERPRO:
IPR036188
INTERPRO:
IPR038732
PFAM:
PF13454
PRIDE:
P77148
REFSEQ:
NP_416183
SMR:
P77148
UNIPROT:
P77148


Operon      
Name: ydhS         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ydhSp3 1747068 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydhSp6 1747082 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1957 1747091 forward nd [RS-EPT-CBR] [2]
  promoter ydhSp5 1747113 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB