RegulonDB RegulonDB 10.9: Gene Form
   

ydiH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

menI ydiH rydB ydiJ ydiHp2 ydiHp2 ydiHp3 ydiHp3 TSS_1986 TSS_1986 rydBp1 rydBp1 rydBp2 rydBp2

Gene      
Name: ydiH    Texpresso search in the literature
Synonym(s): ECK1682, G6911, b1685
Genome position(nucleotides): 1764934 <-- 1765122 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.44
External database links:  
ASAP:
ABE-0005626
ECHOBASE:
EB3724
ECOLIHUB:
ydiH
OU-MICROARRAY:
b1685
STRING:
511145.b1685
COLOMBOS: ydiH


Product      
Name: uncharacterized protein YdiH
Synonym(s): YdiH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.266
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
1 -> 62 MSTQLDPTQLAIEFLRRDQSNLSPAQYLKRLKQLELEFADLLTLSSAELKEEIYFAWRLGVH

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47934N
ECOCYC:
G6911-MONOMER
ECOLIWIKI:
b1685
INTERPRO:
IPR031830
PFAM:
PF15930
PRIDE:
P64476
REFSEQ:
NP_416200
SMR:
P64476
UNIPROT:
P64476


Operon      
Name: ydiJ-menI-ydiH         
Operon arrangement:
Transcription unit        Promoter
ydiJ-menI-ydiH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rydBp2 1764924 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rydBp1 1764930 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1986 1765146 reverse nd [RS-EPT-CBR] [2]
  promoter ydiHp3 1765147 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ydiHp2 1765291 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB