RegulonDB RegulonDB 10.9: Gene Form
   

menI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiJ ydiK menI ydiH terminator TSS_1988 TSS_1988 TSS_1987 TSS_1987 ydiHp2 ydiHp2 ydiHp3 ydiHp3 TSS_1986 TSS_1986

Gene      
Name: menI    Texpresso search in the literature
Synonym(s): ECK1683, G6912, b1686, ydiI
Genome position(nucleotides): 1765222 <-- 1765632 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.58
External database links:  
ASAP:
ABE-0005628
ECHOBASE:
EB3725
ECOLIHUB:
ydiI
OU-MICROARRAY:
b1686
STRING:
511145.b1686
COLOMBOS: menI


Product      
Name: 1,4-dihydroxy-2-naphthoyl-CoA hydrolase
Synonym(s): MenI, YdiI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.945
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
54 -> 54 H
64 -> 64 S
50 -> 127 FGLLHGGASVVLAESIGSVAGYLCTEGEQKVVGLEINANHVRSAREGRVRGVCKPLHLGSRHQVWQIEIFDEKGRLCC
67 -> 67 S
63 -> 63 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016790 - thiolester hydrolase activity
GO:0016289 - CoA hydrolase activity
GO:0061522 - 1,4-dihydroxy-2-naphthoyl-CoA thioesterase activity
biological_process GO:0009234 - menaquinone biosynthetic process
External database links:  
DIP:
DIP-11750N
ECOCYC:
G6912-MONOMER
ECOLIWIKI:
b1686
INTERPRO:
IPR030863
INTERPRO:
IPR029069
INTERPRO:
IPR006683
INTERPRO:
IPR003736
MODBASE:
P77781
PDB:
4K4B
PDB:
4K4A
PDB:
4K49
PDB:
1VI8
PDB:
1VH5
PDB:
1SBK
PFAM:
PF03061
PRIDE:
P77781
REFSEQ:
NP_416201
SMR:
P77781
UNIPROT:
P77781


Operon      
Name: ydiJ-menI-ydiH         
Operon arrangement:
Transcription unit        Promoter
ydiJ-menI-ydiH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1986 1765146 reverse nd [RS-EPT-CBR] [1]
  promoter ydiHp3 1765147 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ydiHp2 1765291 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1987 1767630 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1988 1768977 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB