RegulonDB RegulonDB 11.0: Gene Form

ydiJ gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

ydiJ ydiK menI ydiH terminator TSS_1988 TSS_1988 TSS_1987 TSS_1987 ydiHp2 ydiHp2 ydiHp3 ydiHp3 TSS_1986 TSS_1986

Name: ydiJ    Texpresso search in the literature
Synonym(s): ECK1684, G6913, b1687
Genome position(nucleotides): 1765629 <-- 1768685
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: putative FAD-linked oxidoreductase YdiJ
Synonym(s): YdiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 113.248
Isoelectric point: 7.117
Type Positions Sequence Comment
662 -> 695 FSHEVKEAMSGCLACKACSTQCPIKIDVPEFRSR UniProt: 4Fe-4S ferredoxin-type.


Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004458 - D-lactate dehydrogenase (cytochrome) activity
GO:0008720 - D-lactate dehydrogenase activity
GO:0071949 - FAD binding
biological_process GO:1903457 - lactate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Chen SS., et al., 2013
External database links:  

Name: ydiJ-menI-ydiH         
Operon arrangement:
Transcription unit        Promoter

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1986 1765146 reverse nd [RS-EPT-CBR] [2]
  promoter ydiHp3 1765147 reverse nd [ICWHO] [3]
  promoter ydiHp2 1765291 reverse nd [ICWHO] [3]
  promoter TSS_1987 1767630 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1988 1768977 forward nd [RS-EPT-CBR] [2]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight


 [1] Chen SS., Williamson JR., 2013, Characterization of the ribosome biogenesis landscape in E. coli using quantitative mass spectrometry., J Mol Biol 425(4):767-79

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
