RegulonDB RegulonDB 10.9: Gene Form
   

ydiR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydiS ydiR ydiQ ydiT terminator

Gene      
Name: ydiR    Texpresso search in the literature
Synonym(s): ECK1696, G6921, b1698
Genome position(nucleotides): 1780401 --> 1781339 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0005668
ECHOBASE:
EB3734
ECOLIHUB:
ydiR
OU-MICROARRAY:
b1698
STRING:
511145.b1698
COLOMBOS: ydiR


Product      
Name: putative electron transfer flavoprotein subunit YdiR
Synonym(s): YdiR, putative electron transport flavoprotein, FAD-binding
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 33.77
Isoelectric point: 7.146
Motif(s):
 
Type Positions Sequence
189 -> 270 VDLSKAKRVVGVGRGLAAQDDLKMVHELAAVLNAEVGCSRPIAEGENWMERERYIGVSGVLLKSDLYLTLGISGQIQHMVGG
254 -> 282 LYLTLGISGQIQHMVGGNGAKVIVAINKD
24 -> 168 AQQWGQQVYAIVQNTDQAQAVMPYGPKCLYVLAQNDALQRTENYAESIAALLKDKHPAMLLLAATKRGKALAARLSVQLNAALVNDATAVDIVDGHICAEHRMYGGLAFAQEKINSPLAIITLAPGVQEPCTSDTSHQCPTETVP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.3 - electron carriers
Gene Ontology Terms (GO)  
molecular_function GO:0009055 - electron transfer activity
GO:0050660 - flavin adenine dinucleotide binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0033539 - fatty acid beta-oxidation using acyl-CoA dehydrogenase
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Campbell JW., et al., 2003
External database links:  
ECOCYC:
G6921-MONOMER
ECOLIWIKI:
b1698
INTERPRO:
IPR014731
INTERPRO:
IPR029035
INTERPRO:
IPR018206
INTERPRO:
IPR014730
INTERPRO:
IPR014729
INTERPRO:
IPR001308
MODBASE:
P77378
PFAM:
PF01012
PFAM:
PF00766
PRIDE:
P77378
PROSITE:
PS00696
REFSEQ:
NP_416213
SMART:
SM00893
SMR:
P77378
UNIPROT:
P77378


Operon      
Name: ydiQRST-fadK         
Operon arrangement:
Transcription unit        Promoter
ydiQRST-fadK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Campbell JW., Morgan-Kiss RM., E Cronan J., 2003, A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway., Mol Microbiol 47(3):793-805


RegulonDB