RegulonDB RegulonDB 10.9: Gene Form
   

hxpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hxpB ydjM yniB LexA LexA terminator anti-terminator ydjMp ydjMp TSS_2043 TSS_2043 TSS_2042 (cluster) TSS_2042 (cluster) hxpBp hxpBp yniBp yniBp TSS_2041 TSS_2041

Gene      
Name: hxpB    Texpresso search in the literature
Synonym(s): ECK1725, G6932, b1727, yniC
Genome position(nucleotides): 1809380 --> 1810048 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.72
External database links:  
ASAP:
ABE-0005761
ECHOBASE:
EB3744
ECOLIHUB:
yniC
OU-MICROARRAY:
b1727
STRING:
511145.b1727
COLOMBOS: hxpB


Product      
Name: hexitol phosphatase B
Synonym(s): 2-deoxyglucose-6-phosphate phosphatase, HAD1, HxpB, YniC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.33
Isoelectric point: 4.558
Motif(s):
 
Type Positions Sequence
115 -> 116 SA
11 -> 191 IFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVLTMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGMIASKAARMRSIVV
13 -> 13 D

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0050286 - sorbitol-6-phosphatase activity
GO:0050084 - mannitol-1-phosphatase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0003850 - 2-deoxyglucose-6-phosphatase activity
GO:0004346 - glucose-6-phosphatase activity
GO:0016791 - phosphatase activity
GO:0050308 - sugar-phosphatase activity
GO:0000287 - magnesium ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12777N
ECOCYC:
G6932-MONOMER
ECOLIWIKI:
b1727
INTERPRO:
IPR036412
INTERPRO:
IPR041492
INTERPRO:
IPR006439
INTERPRO:
IPR023198
INTERPRO:
IPR023214
MODBASE:
P77247
PDB:
1TE2
PFAM:
PF13419
PRIDE:
P77247
PRINTS:
PR00413
REFSEQ:
NP_416241
SMR:
P77247
UNIPROT:
P77247


Operon      
Name: hxpB         
Operon arrangement:
Transcription unit        Promoter
hxpB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2041 1809262 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2042 (cluster) 1809339 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2043 1809350 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB