RegulonDB RegulonDB 10.9: Gene Form
   

ydjZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ynjB ydjZ ydjY ynjA ynjC TSS_2062 (cluster) TSS_2062 (cluster) TSS_2061 TSS_2061 TSS_2060 TSS_2060 TSS_2059 TSS_2059

Gene      
Name: ydjZ    Texpresso search in the literature
Synonym(s): ECK1750, G6947, b1752
Genome position(nucleotides): 1834808 --> 1835515 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0005837
ECHOBASE:
EB3758
ECOLIHUB:
ydjZ
OU-MICROARRAY:
b1752
STRING:
511145.b1752
COLOMBOS: ydjZ


Product      
Name: DedA family protein YdjZ
Synonym(s): YdjZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.16
Isoelectric point: 10.54
Motif(s):
 
Type Positions Sequence
65 -> 85 VVSFLLMILQAIAAPLPAFLI
80 -> 197 LPAFLITFANASLFGAFWGGLLSWTSSMAGAALCFFIARVMGREVVEKLTGKTVLDSMDGFFTRYGKHTILVCRLLPFVPFDPISYAAGLTSIRFRSFFIATGLGQLPATIVYSWAGS
203 -> 223 TFWFVTGLFILFALTVVIFMA
96 -> 116 FWGGLLSWTSSMAGAALCFFI
177 -> 197 FFIATGLGQLPATIVYSWAGS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
[2] Serres MH., et al., 2001
External database links:  
ECOCYC:
G6947-MONOMER
ECOLIWIKI:
b1752
INTERPRO:
IPR032816
INTERPRO:
IPR015414
PANTHER:
PTHR12677
PFAM:
PF09335
PRIDE:
P76221
REFSEQ:
NP_416266
UNIPROT:
P76221


Operon      
Name: ydjXYZ-ynjABCD         
Operon arrangement:
Transcription unit        Promoter
ydjXYZ-ynjABCD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2059 1834126 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2060 1834129 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2061 1835147 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2062 (cluster) 1835149 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB