RegulonDB RegulonDB 10.9: Gene Form
   

cdgI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcJ cdgI yeaH terminator anti-terminator yeaJp6 yeaJp6 yeaIp5 yeaIp5 yeaIp6 yeaIp6

Gene      
Name: cdgI    Texpresso search in the literature
Synonym(s): ECK1783, G6971, b1785, yeaI
Genome position(nucleotides): 1870385 --> 1871860 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.48
External database links:  
ASAP:
ABE-0005941
ECHOBASE:
EB3268
ECOLIHUB:
yeaI
OU-MICROARRAY:
b1785
STRING:
511145.b1785
COLOMBOS: cdgI


Product      
Name: putative c-di-GMP binding protein CdgI
Synonym(s): CdgI, YeaI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.101
Isoelectric point: 8.829
Motif(s):
 
Type Positions Sequence
90 -> 110 YLMVVVALFFLNAVIFLFMLM
294 -> 314 IWYISRGIEVSSKLFVVSFLI
266 -> 286 LWPLIALLCLASLCCNLLLLT
328 -> 485 AVHDVLTNIYNRRYFFNSVESLLSRPVVKDFCVMLVDINQFKRINAQWGHRVGDKVLVSIVDIIQQSIRPDDILARLEGEVFGLLFTELNSAQAKIIAERMRKNVELLTGFSNRYDVPEQMTISIGTVFSTGDTRNISLVMTEADKALREAKSEGGNK
407 -> 407 E

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11788N
ECOCYC:
G6971-MONOMER
ECOLIWIKI:
b1785
INTERPRO:
IPR043128
INTERPRO:
IPR033424
INTERPRO:
IPR029787
INTERPRO:
IPR000160
PFAM:
PF17158
PFAM:
PF00990
PRIDE:
P76236
PROSITE:
PS50887
REFSEQ:
NP_416299
SMART:
SM00267
SMR:
P76236
UNIPROT:
P76236


Operon      
Name: cdgI         
Operon arrangement:
Transcription unit        Promoter
cdgI


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeaIp6 1870243 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaIp5 1870364 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaJp6 1871937 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB