RegulonDB RegulonDB 10.9: Gene Form
   

yeaL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nimT nimR yeaL yoaI NimR NimR NimR terminator anti-terminator anti-anti-terminator yeaOp3 yeaOp3 yeaOp4 yeaOp4 nimTp nimTp yeaMp1 yeaMp1 yeaNp9 yeaNp9 nimRp nimRp yeaMp6 yeaMp6 yeaNp4 yeaNp4 yeaLp yeaLp

Gene      
Name: yeaL    Texpresso search in the literature
Synonym(s): ECK1787, G6975, b1789
Genome position(nucleotides): 1874352 --> 1874798 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.81
External database links:  
ASAP:
ABE-0005954
ECHOBASE:
EB3271
ECOLIHUB:
yeaL
OU-MICROARRAY:
b1789
STRING:
511145.b1789
COLOMBOS: yeaL


Product      
Name: DUF441 domain-containing inner membrane protein YeaL
Synonym(s): YeaL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.256
Isoelectric point: 11.652
Motif(s):
 
Type Positions Sequence
51 -> 71 LSIGIIILTIGVMAPIASGTL
7 -> 145 LILLGLAALGFISHNTTVAVSILVLIIVRVTPLSTFFPWIEKQGLSIGIIILTIGVMAPIASGTLPPSTLIHSFLNWKSLVAIAVGVIVSWLGGRGVTLMGSQPQLVAGLLVGTVLGVALFRGVPVGPLIAAGLVSLIV
86 -> 106 LVAIAVGVIVSWLGGRGVTLM
14 -> 34 ALGFISHNTTVAVSILVLIIV
121 -> 141 VLGVALFRGVPVGPLIAAGLV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6975-MONOMER
ECOLIWIKI:
b1789
INTERPRO:
IPR007382
PANTHER:
PTHR38452
PFAM:
PF04284
PRIDE:
P0ACY6
REFSEQ:
NP_416303
UNIPROT:
P0ACY6


Operon      
Name: yeaL         
Operon arrangement:
Transcription unit        Promoter
yeaL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeaNp4 1875463 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaMp6 1875598 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaMp1 1875648 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaNp9 1875648 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaOp4 1876777 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yeaOp3 1876822 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB