RegulonDB RegulonDB 10.9: Gene Form
   

yeaW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeaV yeaW yeaX

Gene      
Name: yeaW    Texpresso search in the literature
Synonym(s): ECK1800, G6988, b1802
Genome position(nucleotides): 1884665 --> 1885789 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.73
External database links:  
ASAP:
ABE-0005997
ECHOBASE:
EB3282
ECOLIHUB:
yeaW
OU-MICROARRAY:
b1802
STRING:
511145.b1802
COLOMBOS: yeaW


Product      
Name: carnitine monooxygenase subunit YeaW
Synonym(s): 2Fe-2S cluster-containing protein, YeaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.561
Isoelectric point: 5.537
Motif(s):
 
Type Positions Sequence
46 -> 134 SWICVAHSSELANANDYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDGNLAHARNCENVANF
47 -> 155 WICVAHSSELANANDYVTREIIGESIVLVRGRDKVLRAFYNVCPHRGHQLLSGEGKAKNVITCPYHAWAFKLDGNLAHARNCENVANFDSDKAQLVPVRLEEYAGFVFI
184 -> 370 DLKLAARFTTRTPANWKNIVDNYLECYHCGPAHPGFSDSVQVDRYWHTMHGNWTLQYGFAKPSEQSFKFEEGTDAAFHGFWLWPCTMLNVTPIKGMMTVIYEFPVDSETTLQNYDIYFTNEELTDEQKSLIEWYRDVFRPEDLRLVESVQKGLKSRGYRGQGRIMADSSGSGISEHGIAHFHNLLAQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0016709 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0042802 - identical protein binding
biological_process GO:0044237 - cellular metabolic process
GO:0009437 - carnitine metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6988-MONOMER
ECOLIWIKI:
b1802
INTERPRO:
IPR039004
INTERPRO:
IPR001663
INTERPRO:
IPR015879
INTERPRO:
IPR015881
INTERPRO:
IPR017941
INTERPRO:
IPR036922
MODBASE:
P0ABR7
PFAM:
PF00355
PFAM:
PF00848
PRIDE:
P0ABR7
PRINTS:
PR00090
PROSITE:
PS51296
PROSITE:
PS00570
REFSEQ:
NP_416316
SMR:
P0ABR7
UNIPROT:
P0ABR7


Operon      
Name: yeaVW         
Operon arrangement:
Transcription unit        Promoter
yeaVW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB