RegulonDB RegulonDB 10.9: Gene Form
   

yobF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebO cspC yobF BtsR BtsR BtsR Cis-reg; thermoregulator anti-terminator yobFp1 yobFp1 yobFp2 yobFp2 cspCp8 cspCp8

Gene      
Name: yobF    Texpresso search in the literature
Synonym(s): ECK1822, G7000, b1824
Genome position(nucleotides): 1907448 <-- 1907591 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.36
External database links:  
ASAP:
ABE-0006072
ECHOBASE:
EB4125
ECOLIHUB:
yobF
OU-MICROARRAY:
b1824
STRING:
511145.b1824
COLOMBOS: yobF


Product      
Name: DUF2527 domain-containing protein YobF
Synonym(s): YobF, small protein involved in stress responses
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 5.212
Isoelectric point: 8.492
Motif(s):
 
Type Positions Sequence
1 -> 38 MCGIFSKEVLSKHVDVEYRFSAEPYIGASCSNVSVLSM

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
biological_process GO:0034605 - cellular response to heat
GO:0036460 - cellular response to cell envelope stress
GO:0097533 - cellular stress response to acid chemical
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Hemm MR., et al., 2010
[2] Hobbs EC., et al., 2010
External database links:  
ECOCYC:
G7000-MONOMER
ECOLIWIKI:
b1824
INTERPRO:
IPR019672
PFAM:
PF10736
PRIDE:
P64508
REFSEQ:
NP_416338
UNIPROT:
P64508


Operon      
Name: yobF-cspC         
Operon arrangement:
Transcription unit        Promoter
yobF-cspC
yobF-cspC


Transcriptional Regulation      
Display Regulation             
Repressed by: BtsR


RNA cis-regulatory element    
   
Cis-reg; thermoregulator cspA thermoregulator
   
   


Regulation by small RNA    
  Display Regulation
small RNA cyaR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cspCp8 1907509 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hemm MR., Paul BJ., Miranda-Rios J., Zhang A., Soltanzad N., Storz G., 2010, Small stress response proteins in Escherichia coli: proteins missed by classical proteomic studies., J Bacteriol 192(1):46-58

 [2] Hobbs EC., Astarita JL., Storz G., 2010, Small RNAs and small proteins involved in resistance to cell envelope stress and acid shock in Escherichia coli: analysis of a bar-coded mutant collection., J Bacteriol 192(1):59-67

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB