RegulonDB RegulonDB 10.9: Gene Form
   

pphA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pphA ryeA yebW sdsR anti-terminator terminator anti-anti-terminator anti-terminator terminator sdsRp sdsRp ryeAp ryeAp

Gene      
Name: pphA    Texpresso search in the literature
Synonym(s): ECK1837, G7011, b1838, prpA, yebX
Genome position(nucleotides): 1922313 <-- 1922969 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.79
External database links:  
ASAP:
ABE-0006114
ECHOBASE:
EB3780
ECOLIHUB:
pphA
OU-MICROARRAY:
b1838
STRING:
511145.b1838
COLOMBOS: pphA


Product      
Name: phosphoprotein phosphatase 1
Synonym(s): PphA, PrpA, YebX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.274
Isoelectric point: 7.454
Motif(s):
 
Type Positions Sequence
107 -> 107 L
18 -> 160 HIWLSGDIHGCLEQLRRKLWHCRFDPWRDLLISVGDVIDRGPQSLRCLQLLEQHWVCAVRGNHEQMAMDALASQQMSLWLMNGGDWFIALADNQQKQAKTALEKCQHLPFILEVHSRTGKHVIAHADYPDDVYEWQKDVDLHQ
24 -> 24 D
26 -> 26 H

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0106307 - protein threonine phosphatase activity
GO:0106306 - protein serine phosphatase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004721 - phosphoprotein phosphatase activity
GO:0008138 - protein tyrosine/serine/threonine phosphatase activity
GO:0004722 - protein serine/threonine phosphatase activity
biological_process GO:0009266 - response to temperature stimulus
GO:0006470 - protein dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Li B., et al., 2005
[2] Zhang Y., et al., 2010
External database links:  
ECOCYC:
G7011-MONOMER
ECOLIWIKI:
b1838
INTERPRO:
IPR004843
INTERPRO:
IPR029052
INTERPRO:
IPR006186
MODBASE:
P55798
PFAM:
PF00149
PRIDE:
P55798
PRODB:
PRO_000023577
PROSITE:
PS00125
REFSEQ:
NP_416352
SMR:
P55798
SWISSMODEL:
P55798
UNIPROT:
P55798


Operon      
Name: sdsR-pphA         
Operon arrangement:
Transcription unit        Promoter
sdsR
sdsR-pphA
sdsR-pphA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Li B., Brown EW., D'Agostino C., Leclerc JE., Cebula TA., 2005, Structure and distribution of the phosphoprotein phosphatase genes, prpA and prpB, among Shigella subgroups., Microbiology 151(Pt 8):2671-83

 [2] Zhang Y., Laing C., Zhang Z., Hallewell J., You C., Ziebell K., Johnson RP., Kropinski AM., Thomas JE., Karmali M., Gannon VP., 2010, Lineage and host source are both correlated with levels of Shiga toxin 2 production by Escherichia coli O157:H7 strains., Appl Environ Microbiol 76(2):474-82


RegulonDB