RegulonDB RegulonDB 10.9: Gene Form
   

yeeX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeA yoeF yeeX yoeD TSS_2315 (cluster) TSS_2315 (cluster) yeeXp4 yeeXp4 TSS_2314 TSS_2314 TSS_2313 TSS_2313 TSS_2312 TSS_2312

Gene      
Name: yeeX    Texpresso search in the literature
Synonym(s): ECK2001, G7087, b2007
Genome position(nucleotides): 2079032 <-- 2079361 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.88
External database links:  
ASAP:
ABE-0006663
ECHOBASE:
EB3172
ECOLIHUB:
yeeX
OU-MICROARRAY:
b2007
STRING:
511145.b2007
COLOMBOS: yeeX


Product      
Name: DUF496 domain-containing protein YeeX
Synonym(s): YeeX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.778
Isoelectric point: 9.94
Motif(s):
 
Type Positions Sequence
7 -> 7 S
8 -> 99 FQDVLEFVRLFRRKNKLQREIQDVEKKIRDNQKRVLLLDNLSDYIKPGMSVEAIQGIIASMKGDYEDRVDDYIIKNAELSKERRDISKKLKA
1 -> 1 M

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-47887N
ECOCYC:
G7087-MONOMER
ECOLIWIKI:
b2007
INTERPRO:
IPR007458
PANTHER:
PTHR39591
PFAM:
PF04363
PRIDE:
P0A8M6
REFSEQ:
NP_416511
UNIPROT:
P0A8M6


Operon      
Name: yeeX         
Operon arrangement:
Transcription unit        Promoter
yeeX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2312 2079341 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2313 2079386 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2314 2079416 reverse nd [RS-EPT-CBR] [2]
  promoter yeeXp4 2079417 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2315 (cluster) 2079469 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB