RegulonDB RegulonDB 10.9: Gene Form
   

pphC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pphC yegL yegJ sibA ibsA SibA sibAp sibAp

Gene      
Name: pphC    Texpresso search in the literature
Synonym(s): ECK2066, G7111, b2072, yegK
Genome position(nucleotides): 2151711 <-- 2152472 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0006865
ECHOBASE:
EB3807
ECOLIHUB:
yegK
OU-MICROARRAY:
b2072
STRING:
511145.b2072
COLOMBOS: pphC


Product      
Name: protein-serine/threonine phosphatase PphC
Synonym(s): PphC, YegK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.208
Isoelectric point: 4.177
Motif(s):
 
Type Positions Sequence
11 -> 220 VGTSHISADLPCQDACQMQIAWLNDQQPLLSVFVADGAGSVSQGGEGAMLAVNEAMAYMSQKVQGGELGLNDVLATNMVLTIRQRLFAEAEAKELAVRDFACTFLGLISSPDGTLIMQIGDGGVVVDLGHGLQLPLTPMAGEYANMTHFITDEDAVSRLETFTSTGRAHKVAAFTDGIQRLALNMLDNSPHVPFFTPFFNGLAAATQEQL
46 -> 46 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
molecular_function GO:0106307 - protein threonine phosphatase activity
GO:0106306 - protein serine phosphatase activity
GO:0016787 - hydrolase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0016791 - phosphatase activity
GO:0004722 - protein serine/threonine phosphatase activity
biological_process GO:0006470 - protein dephosphorylation
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Rajagopalan K., et al., 2018
External database links:  
ECOCYC:
G7111-MONOMER
ECOLIWIKI:
b2072
INTERPRO:
IPR036457
PFAM:
PF13672
PRIDE:
P76395
REFSEQ:
NP_416576
UNIPROT:
P76395


Operon      
Name: yegL-pphC         
Operon arrangement:
Transcription unit        Promoter
yegL-pphC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Rajagopalan K., Dworkin J., Nagle E., 2018, Identification and Biochemical Characterization of a Novel Protein Phosphatase 2C-Like Ser/Thr Phosphatase in Escherichia coli., J Bacteriol 200(18)


RegulonDB