RegulonDB RegulonDB 10.9: Gene Form
   

yegP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trhP baeR yegP baeS yegQp1 yegQp1

Gene      
Name: yegP    Texpresso search in the literature
Synonym(s): ECK2076, G7117, b2080
Genome position(nucleotides): 2165189 --> 2165521 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.05
External database links:  
ASAP:
ABE-0006888
ECHOBASE:
EB3812
ECOLIHUB:
yegP
OU-MICROARRAY:
b2080
STRING:
511145.b2080
COLOMBOS: yegP


Product      
Name: DUF1508 domain-containing protein YegP
Synonym(s): YegP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 12.024
Isoelectric point: 9.984
Motif(s):
 
Type Positions Sequence
61 -> 108 ASNGKFYFNLKAANHQIIGSSQMYATAQSRETGIASVKANGTSQTVKD
11 -> 57 SDNQFRFVLKAGNGETILTSELYTSKTSAEKGIASVRSNSPQEERYE
10 -> 58 SSDNQFRFVLKAGNGETILTSELYTSKTSAEKGIASVRSNSPQEERYEK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
biological_process GO:0006302 - double-strand break repair
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7117-MONOMER
ECOLIWIKI:
b2080
INTERPRO:
IPR036913
INTERPRO:
IPR010879
PDB:
2K8E
PFAM:
PF07411
PRIDE:
P76402
REFSEQ:
NP_416584
SMR:
P76402
UNIPROT:
P76402


Operon      
Name: yegP         
Operon arrangement:
Transcription unit        Promoter
yegP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yegQp1 2165591 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yegQp1 2165591 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB