RegulonDB RegulonDB 10.9: Gene Form
   

insF5 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF5 gatD insF5 insE5 TSS_2406 (cluster) TSS_2406 (cluster)

Gene      
Name: insF5    Texpresso search in the literature
Synonym(s): ECK0299, G7126, b2089, tra5-4
Genome position(nucleotides): 2170532 --> 2171398 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.13
External database links:  
ASAP:
ABE-0006919
ECOLIHUB:
insF-5
ECOO157CYC:
Z1573
OU-MICROARRAY:
b0372
COLOMBOS: insF5


Product      
Name: IS3 element protein InsF
Synonym(s): InsF5
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 33.54
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
231 -> 287 ESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
124 -> 287 YASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
52 -> 101 VVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
127 -> 224 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCC

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4447
INTERPRO:
IPR001584
INTERPRO:
IPR012337
INTERPRO:
IPR025948
INTERPRO:
IPR036397
PFAM:
PF13333
PFAM:
PF13276
PFAM:
PF00665
PRIDE:
P0CF83
PROSITE:
PS50994
REFSEQ:
NP_416593
UNIPROT:
P0CF83


Operon      
Name: insE5EF5F5         
Operon arrangement:
Transcription unit        Promoter
insE5EF5F5


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2406 (cluster) 2172607 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB