RegulonDB RegulonDB 10.9: Gene Form
   

preT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

preT preA mglC yeiS CRP TSS_2455 TSS_2455 preTp preTp

Gene      
Name: preT    Texpresso search in the literature
Synonym(s): ECK2139, G7145, b2146, yeiT
Genome position(nucleotides): 2234033 --> 2235271 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.49
External database links:  
ASAP:
ABE-0007096
ECHOBASE:
EB3827
ECOLIHUB:
yeiT
OU-MICROARRAY:
b2146
STRING:
511145.b2146
COLOMBOS: preT


Product      
Name: NAD-dependent dihydropyrimidine dehydrogenase subunit PreT
Synonym(s): PreT, YeiT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.329
Isoelectric point: 5.067
Motif(s):
 
Type Positions Sequence
7 -> 113 LDELTPAFTSLLAIKEASRCLLCHDAPCSQACPAQTDPGKFIRSIYFRNFKGAAETIRENNALGAVCARVCPTEKLCQSGCTRAGVDAPIDIGRLQRFVTDFEQQTG
126 -> 394 KVAIIGAGPAGLQASVTLTNQGYDVTIYEKEAHPGGWLRNGIPQFRLPQSVLDAEIARIEKMGVTIKCNNEVGNTLTLEQLKAENRAVLVTVGLSSGSGLPLFEHSDVEIAVDFLQRARQAQGDISIPQSALIIGGGDVAMDVASTLKVLGCQAVTCVAREELDEFPASEKEFTSARELGVSIIDGFTPVAVEGNKVTFKHVRLSGELTMAADKIILAVGQHARLDAFAELEPQRNTIKTQNYQTRDPQVFAAGDIVEGDKTVVYAVKT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0003954 - NADH dehydrogenase activity
GO:0004159 - dihydrouracil dehydrogenase (NAD+) activity
biological_process GO:0006208 - pyrimidine nucleobase catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28055N
ECOCYC:
G7145-MONOMER
ECOLIWIKI:
b2146
INTERPRO:
IPR023753
INTERPRO:
IPR036188
INTERPRO:
IPR028261
INTERPRO:
IPR009051
MODBASE:
P76440
PFAM:
PF07992
PFAM:
PF14691
PRIDE:
P76440
REFSEQ:
NP_416651
SMR:
P76440
UNIPROT:
P76440


Operon      
Name: preTA         
Operon arrangement:
Transcription unit        Promoter
preTA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2455 2234353 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB