RegulonDB RegulonDB 10.9: Gene Form
   

yfaP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaQ atoB yfaP yfaPp4 yfaPp4

Gene      
Name: yfaP    Texpresso search in the literature
Synonym(s): ECK2218, G7152, b2225
Genome position(nucleotides): 2327367 <-- 2328143 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.51
External database links:  
ASAP:
ABE-0007357
ECHOBASE:
EB3831
ECOLIHUB:
yfaP
OU-MICROARRAY:
b2225
STRING:
511145.b2225
COLOMBOS: yfaP


Product      
Name: DUF2135 domain-containing protein YfaP
Synonym(s): YfaP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 28.304
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
20 -> 258 EGVQEVEIDAPLSGWHPAEGEDASFSQSINYPASSVNMADDQNISAQIRGKIKNYAAAGKVQQGRLVVNGASMPQRIESDGSFARPYIFTEGSNSVQVISPDGQSRQKMQFYSTPGTGTIRARLRLVLSWDTDNTDLDLHVVTPDGEHAWYGNTVLKNSGALDMDVTTGYGPEIFAMPAPIHGRYQVYINYYGGRSETELTTAQLTLITDEGSVNEKQETFIVPMRNAGELTLVKSFDW
199 -> 244 PIHGRYQVYINYYGGRSETELTTAQLTLITDEGSVNEKQETFIVPM
1 -> 19 MRKIFLPLLLVALSPVAHS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7152-MONOMER
ECOLIWIKI:
b2225
INTERPRO:
IPR019220
INTERPRO:
IPR012039
PFAM:
PF09906
PRIDE:
P76462
REFSEQ:
NP_416729
SMR:
P76462
UNIPROT:
P76462


Operon      
Name: yfaATSQP         
Operon arrangement:
Transcription unit        Promoter
yfaATSQP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaPp4 2328199 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB