RegulonDB RegulonDB 10.9: Gene Form
   

yfaT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaS gyrA yfaA yfaQ yfaT anti-anti-terminator anti-terminator terminator TSS_2505 TSS_2505 TSS_2504 TSS_2504 TSS_2503 TSS_2503 TSS_2502 TSS_2502 yfaPp4 yfaPp4

Gene      
Name: yfaT    Texpresso search in the literature
Synonym(s): ECK2221, G7156, b2229
Genome position(nucleotides): 2334336 <-- 2334959 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.44
External database links:  
ASAP:
ABE-0007366
ECHOBASE:
EB3835
ECOLIHUB:
yfaT
OU-MICROARRAY:
b2229
STRING:
511145.b2229
COLOMBOS: yfaT


Product      
Name: DUF1175 domain-containing protein YfaT
Synonym(s): YfaT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 23.767
Isoelectric point: 8.609
Motif(s):
 
Type Positions Sequence
20 -> 207 EMLNVEQSGLFRAWFVRIAQEQLRQGPSPRWYQQDCAGLVRFAANETLKVHDSKWLKSNGLSSQYLPPEMTLTPEQRQLAQNWNQGNGKTGPYVTAINLIQYNSQFIGQDINQALPGDMIFFDQGDAQHLMVWMGRYVIYHTGSATKTDNGMRAVSLQQLMTWKDTRWIPNDSNPNFIGIYRLNFLAR
1 -> 19 MRHGLLALICWLCCVVAHS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7156-MONOMER
ECOLIWIKI:
b2229
INTERPRO:
IPR009558
PFAM:
PF06672
PRIDE:
P76466
REFSEQ:
NP_416732
UNIPROT:
P76466


Operon      
Name: yfaATSQP         
Operon arrangement:
Transcription unit        Promoter
yfaATSQP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaPp4 2328199 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2502 2338373 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2503 2338375 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2504 2338445 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2505 2338825 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB