RegulonDB RegulonDB 10.9: Gene Form
   

yfaZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaY yfaZ nudI anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator nudIp3 nudIp3 yfaZp4 yfaZp4 yfaZp5 yfaZp5 yfaYp yfaYp

Gene      
Name: yfaZ    Texpresso search in the literature
Synonym(s): ECK2243, G7163, b2250
Genome position(nucleotides): 2363733 <-- 2364275 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.22
External database links:  
ASAP:
ABE-0007445
ECHOBASE:
EB3841
ECOLIHUB:
yfaZ
OU-MICROARRAY:
b2250
STRING:
511145.b2250
COLOMBOS: yfaZ


Product      
Name: putative porin YfaZ
Synonym(s): YfaZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 18.61
Isoelectric point: 4.482
Motif(s):
 
Type Positions Sequence
22 -> 180 MSISGQAGKEYTNIGVGFGTETTGLALSGNWTHNDDDGDVAGVGLGLNLPLGPLMATVGGKGVYTNPNYGDEGYAAAVGGGLQWKIGNSFRLFGEYYYSPDSLSSGIQSYEEANAGARYTIMRPVSIEAGYRYLNLSGKDGNRDNAVADGPYVGVNASF
1 -> 180 MKKIALAGLAGMLLVSASVNAMSISGQAGKEYTNIGVGFGTETTGLALSGNWTHNDDDGDVAGVGLGLNLPLGPLMATVGGKGVYTNPNYGDEGYAAAVGGGLQWKIGNSFRLFGEYYYSPDSLSSGIQSYEEANAGARYTIMRPVSIEAGYRYLNLSGKDGNRDNAVADGPYVGVNASF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Berven FS., et al., 2004
External database links:  
ECOCYC:
G7163-MONOMER
ECOLIWIKI:
b2250
INTERPRO:
IPR011250
INTERPRO:
IPR023614
INTERPRO:
IPR009998
PFAM:
PF07437
PRIDE:
P76471
REFSEQ:
NP_416753
UNIPROT:
P76471


Operon      
Name: yfaZ         
Operon arrangement:
Transcription unit        Promoter
yfaZ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaZp5 2364317 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfaZp4 2364372 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter nudIp3 2364525 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Berven FS., Flikka K., Jensen HB., Eidhammer I., 2004, BOMP: a program to predict integral beta-barrel outer membrane proteins encoded within genomes of Gram-negative bacteria., Nucleic Acids Res 32(Web Server issue):W394-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB