RegulonDB RegulonDB 10.9: Gene Form
   

nudI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ais yfaZ nudI anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator nudIp3 nudIp3 yfaZp4 yfaZp4 yfaZp5 yfaZp5

Gene      
Name: nudI    Texpresso search in the literature
Synonym(s): ECK2244, G7164, b2251, yfaO
Genome position(nucleotides): 2364554 --> 2364979 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.65
External database links:  
ASAP:
ABE-0007449
ECHOBASE:
EB3060
ECOLIHUB:
nudI
OU-MICROARRAY:
b2251
STRING:
511145.b2251
COLOMBOS: nudI


Product      
Name: pyrimidine deoxynucleotide diphosphatase NudI
Synonym(s): NudI, Orf141, YfaO, pyrimidine deoxynucleoside triphosphate pyrophosphohydrolase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.371
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
1 -> 141 MRQRTIVCPLIQNDGAYLLCKMADDRGVFPGQWAISGGGVEPGERIEEALRREIREELGEQLLLTEITPWTFSDDIRTKTYADGRKEEIYMIYLIFDCVSANREVKINEEFQDYAWVKPEDLVHYDLNVATRKTLRLKGLL
38 -> 59 GGVEPGERIEEALRREIREELG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0004170 - dUTP diphosphatase activity
GO:0047429 - nucleoside-triphosphate diphosphatase activity
GO:0047840 - dCTP diphosphatase activity
GO:0004551 - nucleotide diphosphatase activity
GO:0000287 - magnesium ion binding
GO:0035529 - NADH pyrophosphatase activity
GO:0036218 - dTTP diphosphatase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Wang PH., et al., 2018
External database links:  
ECOCYC:
G7164-MONOMER
ECOLIWIKI:
b2251
INTERPRO:
IPR023781
INTERPRO:
IPR020476
INTERPRO:
IPR020084
INTERPRO:
IPR015797
INTERPRO:
IPR000086
MODBASE:
P52006
PFAM:
PF00293
PRIDE:
P52006
PRINTS:
PR00502
PRODB:
PRO_000023426
PROSITE:
PS51462
PROSITE:
PS00893
REFSEQ:
NP_416754
SMR:
P52006
UNIPROT:
P52006


Operon      
Name: nudI         
Operon arrangement:
Transcription unit        Promoter
nudI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaZp5 2364317 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yfaZp4 2364372 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter nudIp3 2364525 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Wang PH., Khusnutdinova AN., Luo F., Xiao J., Nemr K., Flick R., Brown G., Mahadevan R., Edwards EA., Yakunin AF., 2018, Biosynthesis and Activity of Prenylated FMN Cofactors., Cell Chem Biol 25(5):560-570.e6

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB