RegulonDB RegulonDB 10.9: Gene Form
   

ais gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arnB ais nudI aisp4 aisp4 aisp7 aisp7 TSS_2516 TSS_2516 aisp8 aisp8

Gene      
Name: ais    Texpresso search in the literature
Synonym(s): ECK2245, G7165, b2252, pagH, pmrG
Genome position(nucleotides): 2365018 <-- 2365620 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.28
External database links:  
ASAP:
ABE-0007451
ECHOBASE:
EB2949
ECOLIHUB:
ais
OU-MICROARRAY:
b2252
STRING:
511145.b2252
COLOMBOS: ais


Product      
Name: putative lipopolysaccharide core heptose(II)-phosphate phosphatase
Synonym(s): Ais, PagH, PmrG
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 22.257
Isoelectric point: 9.414
Motif(s):
 
Type Positions Sequence
56 -> 129 VVLFRHAERCDRSTNQCLSDKTGITVKGTQDARELGNAFSADIPDFDLYSSNTVRTIQSATWFSAGKKLTVDKR
200 -> 200 H
26 -> 200 GLGTHAAWSSNGLPRIDNKTLARLAQQHPVVVLFRHAERCDRSTNQCLSDKTGITVKGTQDARELGNAFSADIPDFDLYSSNTVRTIQSATWFSAGKKLTVDKRLLQCGNEIYSAIKDLQSKAPDKNIVIFTHNHCLTYIAKDKRDATFKPDYLDGLVMHVEKGKVYLDGEFVNH
1 -> 25 MLAFCRSSLKSKKYIIILLALAAIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0016791 - phosphatase activity
biological_process GO:0008653 - lipopolysaccharide metabolic process
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7165-MONOMER
ECOLIWIKI:
b2252
INTERPRO:
IPR013078
INTERPRO:
IPR029033
INTERPRO:
IPR011310
MODBASE:
P45565
PFAM:
PF00300
PRIDE:
P45565
PRODB:
PRO_000022073
REFSEQ:
NP_416755
SMR:
P45565
UNIPROT:
P45565


Operon      
Name: ais         
Operon arrangement:
Transcription unit        Promoter
ais


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter aisp8 2365698 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2516 2365723 reverse nd [RS-EPT-CBR] [2]
  promoter aisp7 2365754 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter aisp4 2365756 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB