RegulonDB RegulonDB 10.9: Gene Form
   

arnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arnB arnC ais TSS_2517 TSS_2517 aisp4 aisp4 aisp7 aisp7 TSS_2516 TSS_2516 aisp8 aisp8

Gene      
Name: arnB    Texpresso search in the literature
Synonym(s): ECK2246, G7166, b2253, pmrH, yfbE
Genome position(nucleotides): 2365910 --> 2367067 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.3
External database links:  
ASAP:
ABE-0007456
ECHOBASE:
EB3842
ECOLIHUB:
arnB
OU-MICROARRAY:
b2253
STRING:
511145.b2253
COLOMBOS: arnB


Product      
Name: UDP-4-amino-4-deoxy-L-arabinose aminotransferase
Synonym(s): ArnB, PmrH, YfbE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.238
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
18 -> 380 MGVEELAAVKEVLESGWITTGPKNQALEQAFCQLTGNQHAIAVSSATAGMHITLMALKIGKGDEVITPSLTWVSTLNMISLLGATPVMVDVDRDTLMVTPEAIESAITPRTKAIIPVHYAGAPADIDAIRAIGERYGIAVIEDAAHAVGTYYKGRHIGAKGTAIFSFHAIKNITCAEGGLIVTDNENLARQLRMLKFHGLGVDAYDRQTWGRAPQAEVLTPGYKYNLTDINAAIALTQLVKLEHLNTRRREIAQQYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICSLPLFPDMTTADADHVITALQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0099620 - UDP-4-amino-4-deoxy-L-arabinose aminotransferase
GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0030170 - pyridoxal phosphate binding
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0006629 - lipid metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0046493 - lipid A metabolic process
GO:0046677 - response to antibiotic
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7166-MONOMER
ECOLIWIKI:
b2253
INTERPRO:
IPR022850
INTERPRO:
IPR015424
INTERPRO:
IPR000653
INTERPRO:
IPR015421
INTERPRO:
IPR015422
MODBASE:
P77690
PANTHER:
PTHR30244
PFAM:
PF01041
PRIDE:
P77690
PRODB:
PRO_000022139
REFSEQ:
NP_416756
SMR:
P77690
SWISSMODEL:
P77690
UNIPROT:
P77690


Operon      
Name: arnBCADTEF         
Operon arrangement:
Transcription unit        Promoter
arnBCADTEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter aisp8 2365698 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2516 2365723 reverse nd [RS-EPT-CBR] [2]
  promoter aisp7 2365754 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter aisp4 2365756 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2517 2367228 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB