RegulonDB RegulonDB 10.9: Gene Form
   

yfcG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfcG yfcF folX TSS_2617 TSS_2617 TSS_2616 TSS_2616 TSS_2615 TSS_2615 TSS_2614 TSS_2614

Gene      
Name: yfcG    Texpresso search in the literature
Synonym(s): ECK2296, G7194, b2302
Genome position(nucleotides): 2420621 --> 2421268 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.39
External database links:  
ASAP:
ABE-0007600
ECHOBASE:
EB3863
ECOLIHUB:
yfcG
OU-MICROARRAY:
b2302
STRING:
511145.b2302
COLOMBOS: yfcG


Product      
Name: disulfide reductase
Synonym(s): GST N1-1, YfcG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.516
Isoelectric point: 6.971
Motif(s):
 
Type Positions Sequence
14 -> 14 K
166 -> 166 C
1 -> 87 MIDLYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAEKTGLFL
4 -> 81 LYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAE
11 -> 11 N

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0015036 - disulfide oxidoreductase activity
biological_process GO:0006979 - response to oxidative stress
GO:0055114 - oxidation-reduction process
GO:0098869 - cellular oxidant detoxification
External database links:  
ECOCYC:
G7194-MONOMER
ECOLIWIKI:
b2302
INTERPRO:
IPR036249
INTERPRO:
IPR036282
INTERPRO:
IPR004045
INTERPRO:
IPR004046
INTERPRO:
IPR010987
MODBASE:
P77526
PDB:
5HFK
PDB:
3GX0
PFAM:
PF00043
PFAM:
PF02798
PRIDE:
P77526
PROSITE:
PS50405
PROSITE:
PS50404
REFSEQ:
NP_416805
SMR:
P77526
SWISSMODEL:
P77526
UNIPROT:
P77526


Operon      
Name: yfcG         
Operon arrangement:
Transcription unit        Promoter
yfcG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2614 2421299 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2615 2421301 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2616 2421608 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2617 2421619 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB