RegulonDB RegulonDB 10.9: Gene Form
   

fadJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadJ fadI sixA yfcZ ArcA FadR anti-anti-terminator anti-terminator terminator fadIp fadIp sixAp sixAp TSS_2652 TSS_2652

Gene      
Name: fadJ    Texpresso search in the literature
Synonym(s): ECK2335, G7212, b2341, yfcX
Genome position(nucleotides): 2457015 <-- 2459159 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.26
Reference(s): [1] Snell KD., et al., 2002
External database links:  
ASAP:
ABE-0007723
ECHOBASE:
EB3879
ECOLIHUB:
fadJ
MIM:
609015
MIM:
609016
OU-MICROARRAY:
b2341
STRING:
511145.b2341
COLOMBOS: fadJ


Product      
Name: 3-hydroxyacyl-CoA dehydrogenase FadJ
Synonym(s): FadJ, FadJ component of anaerobic fatty acid oxidation complex, YfcX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 77.072
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
306 -> 714 APLNSVGILGGGLMGGGIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKVRRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIFASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQGKTPIVVRDKAGFYVNRILAPYINEAIRMLTQGERVEHIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLYGQKGRKSKKQVDPAIYPLIGTQGQGRISAPQVAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLGGPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGESFWKTTATDLQ
15 -> 204 NIAVITIDVPGEKMNTLKAEFASQVRAIIKQLRENKELRGVVFVSAKPDNFIAGADINMIGNCKTAQEAEALARQGQQLMAEIHALPIQVIAAIHGACLGGGLELALACHGRVCTDDPKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKK
311 -> 489 VGILGGGLMGGGIAYVTACKAGIPVRIKDINPQGINHALKYSWDQLEGKVRRRHLKASERDKQLALISGTTDYRGFAHRDLIIEAVFENLELKQQMVAEVEQNCAAHTIFASNTSSLPIGDIAAHATRPEQVIGLHFFSPVEKMPLVEIIPHAGTSAQTIATTVKLAKKQGKTPIVVRD
492 -> 586 GFYVNRILAPYINEAIRMLTQGERVEHIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERFSAPANVVSSILNDDRKGRKNGRGFYLY
618 -> 703 VAERCVMLMLNEAVRCVDEQVIRSVRDGDIGAVFGIGFPPFLGGPFRYIDSLGAGEVVAIMQRLATQYGSRFTPCERLVEMGARGE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016509 - long-chain-3-hydroxyacyl-CoA dehydrogenase activity
GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0016853 - isomerase activity
GO:0016491 - oxidoreductase activity
GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase activity
GO:0004300 - enoyl-CoA hydratase activity
GO:0008692 - 3-hydroxybutyryl-CoA epimerase activity
GO:0051287 - NAD binding
biological_process GO:0008152 - metabolic process
GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0016042 - lipid catabolic process
GO:0006635 - fatty acid beta-oxidation
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [2] Park SJ., et al., 2003
[3] Tappel RC., et al., 2012
External database links:  
DIP:
DIP-11990N
ECOCYC:
G7212-MONOMER
ECOLIWIKI:
b2341
INTERPRO:
IPR008927
INTERPRO:
IPR012802
INTERPRO:
IPR029045
INTERPRO:
IPR036291
INTERPRO:
IPR006176
INTERPRO:
IPR006108
INTERPRO:
IPR001753
INTERPRO:
IPR006180
MODBASE:
P77399
PFAM:
PF00378
PFAM:
PF00725
PFAM:
PF02737
PRIDE:
P77399
PROSITE:
PS00067
REFSEQ:
NP_416843
SMR:
P77399
UNIPROT:
P77399


Operon      
Name: fadIJ         
Operon arrangement:
Transcription unit        Promoter
fadIJ


Transcriptional Regulation      
Display Regulation             
Repressed by: FadR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2652 2456916 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Snell KD., Feng F., Zhong L., Martin D., Madison LL., 2002, YfcX enables medium-chain-length poly(3-hydroxyalkanoate) formation from fatty acids in recombinant Escherichia coli fadB strains., J Bacteriol 184(20):5696-705

 [2] Park SJ., Lee SY., 2003, Identification and characterization of a new enoyl coenzyme A hydratase involved in biosynthesis of medium-chain-length polyhydroxyalkanoates in recombinant Escherichia coli., J Bacteriol 185(18):5391-7

 [3] Tappel RC., Wang Q., Nomura CT., 2012, Precise control of repeating unit composition in biodegradable poly(3-hydroxyalkanoate) polymers synthesized by Escherichia coli., J Biosci Bioeng 113(4):480-6

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB