RegulonDB RegulonDB 10.9: Gene Form
   

murQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murP murQ murR MurR MurR MurR CRP murRp murRp murQp2 murQp2 murQp1 murQp1

Gene      
Name: murQ    Texpresso search in the literature
Synonym(s): ECK2423, G7263, b2428, yfeU
Genome position(nucleotides): 2545773 --> 2546669 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.51
Reference(s): [1] Jaeger T., et al., 2008
External database links:  
ASAP:
ABE-0008007
ECHOBASE:
EB3914
ECOLIHUB:
murQ
MIM:
613463
OU-MICROARRAY:
b2428
STRING:
511145.b2428
COLOMBOS: murQ


Product      
Name: N-acetylmuramic acid 6-phosphate etherase
Synonym(s): MurQ, YfeU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.22
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
55 -> 218 IHAQVSGGGRLIYLGAGTSGRLGILDASECPPTYGVKPGLVVGLIAGGEYAIQHAVEGAEDSREGGVNDLKNINLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAITPIVGAEVVTGSSRMKAGTAQKLVLNMLSTGLMIKSGK
114 -> 114 E
128 -> 208 NLTAQDVVVGIAASGRTPYVIAGLEYARQLGCRTVGISCNPGSAVSTTAEFAITPIVGAEVVTGSSRMKAGTAQKLVLNML
115 -> 115 D
83 -> 83 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.34 - murein turnover, recycling
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0016835 - carbon-oxygen lyase activity
GO:0016803 - ether hydrolase activity
GO:0097367 - carbohydrate derivative binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006040 - amino sugar metabolic process
GO:0009254 - peptidoglycan turnover
GO:0046348 - amino sugar catabolic process
GO:1901135 - carbohydrate derivative metabolic process
GO:0097173 - N-acetylmuramic acid catabolic process
GO:0097175 - 1,6-anhydro-N-acetyl-beta-muramic acid catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7263-MONOMER
ECOLIWIKI:
b2428
INTERPRO:
IPR040190
INTERPRO:
IPR005488
INTERPRO:
IPR005486
INTERPRO:
IPR001347
MODBASE:
P76535
PANTHER:
PTHR10088
PANTHER:
PTHR10088:SF5
PFAM:
PF01380
PRIDE:
P76535
PRODB:
PRO_000023321
PROSITE:
PS51464
PROSITE:
PS01272
REFSEQ:
NP_416923
SMR:
P76535
SWISSMODEL:
P76535
UNIPROT:
P76535


Operon      
Name: murQP-yfeW         
Operon arrangement:
Transcription unit        Promoter
murQP
murQP
murQP
murQP-yfeW


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: MurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jaeger T., Mayer C., 2008, The transcriptional factors MurR and catabolite activator protein regulate N-acetylmuramic acid catabolism in Escherichia coli., J Bacteriol 190(20):6598-608


RegulonDB