RegulonDB RegulonDB 10.9: Gene Form
   

eutL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutC eutL eutK

Gene      
Name: eutL    Texpresso search in the literature
Synonym(s): ECK2434, G7271, b2439, yffJ
Genome position(nucleotides): 2555741 <-- 2556400 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.36
External database links:  
ASAP:
ABE-0008041
ECHOBASE:
EB3923
ECOLIHUB:
eutL
OU-MICROARRAY:
b2439
STRING:
511145.b2439
COLOMBOS: eutL


Product      
Name: putative structural protein, ethanolamine utilization microcompartment
Synonym(s): EutL, YffJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 22.788
Isoelectric point: 4.533
Motif(s):
 
Type Positions Sequence
36 -> 107 SLGLISADSDDVTYIAADEATKQAMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMIAHI
160 -> 208 YGIDAALKSADVQLATYVPPPSETNYSAAFLTGSQAACKAACNAFTDAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
Gene Ontology Terms (GO)  
cellular_component GO:0031469 - polyhedral organelle
GO:0031471 - ethanolamine degradation polyhedral organelle
molecular_function GO:0005198 - structural molecule activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
biological_process GO:0046336 - ethanolamine catabolic process
External database links:  
DIP:
DIP-9536N
ECOCYC:
G7271-MONOMER
ECOLIWIKI:
b2439
INTERPRO:
IPR037233
INTERPRO:
IPR030983
INTERPRO:
IPR009193
INTERPRO:
IPR000249
PDB:
3MPV
PDB:
3I87
PDB:
3I82
PDB:
3GFH
PFAM:
PF00936
PRIDE:
P76541
PRODB:
PRO_000022544
REFSEQ:
NP_416934
SMART:
SM00877
SMR:
P76541
UNIPROT:
P76541


Operon      
Name: eutBCLKR         
Operon arrangement:
Transcription unit        Promoter
eutBCLKR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB