RegulonDB RegulonDB 11.1: Gene Form
   

intZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutB intZ yffL terminator anti-terminator intZp3 intZp3

Gene      
Name: intZ    Texpresso search in the literature
Synonym(s): ECK2437, G7272, b2442
Genome position(nucleotides): 2558858 --> 2560066
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.68
External database links:  
ASAP:
ABE-0008052
ECHOBASE:
EB3924
ECOLIHUB:
intZ
ECOO157CYC:
Z5890
ECOO157CYC:
Z1559
ECOO157CYC:
Z1835
ECOO157CYC:
INTL
ECOO157CYC:
Z0324
ECOO157CYC:
Z1120
OU-MICROARRAY:
b2442
STRING:
511145.b2442
COLOMBOS: intZ


Product      
Name: CPZ-55 prophage; putative phage integrase IntZ
Synonym(s): IntZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.381
Isoelectric point: 10.54
Motif(s):
 
Type Positions Sequence Comment
6 -> 92 LTAKAIDAAQPQDKPYKLTDSLTPGLFLLVHPNGSKYWRFRYWLNKREFLQAIGVYPLITLKEARRRATESRSLIANGINPVEQARK
103 -> 183 AGFKKVAEDWFATRVGGWSESYAKQVRSALEKDVYPVLGKRSIVDITARDVLALLQKKERTAPEQARKLRRRIGEIFKFAV UniProt: Core-binding (CB).
206 -> 381 GHNAWIPISEIPAFYKALERAGSVQIQTAIRLLILTALRTAELRLCRWEWINLEDATITLPAEVMKARRPHVVPLSRQAVELLQDQFTRSGYSAFVFPGRFMDKPLSASAILKALERIGYKSIATGHGWRTTFSTALNESGRYSPDWIEIQLAHVPKGIRGVYNQAAYLKQRRAMM UniProt: Tyr recombinase.
214 -> 370 SEIPAFYKALERAGSVQIQTAIRLLILTALRTAELRLCRWEWINLEDATITLPAEVMKARRPHVVPLSRQAVELLQDQFTRSGYSAFVFPGRFMDKPLSASAILKALERIGYKSIATGHGWRTTFSTALNESGRYSPDWIEIQLAHVPKGIRGVYNQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0044826 - viral genome integration into host DNA
GO:0006310 - DNA recombination
GO:0015074 - DNA integration
GO:0046718 - viral entry into host cell
GO:0075713 - establishment of integrated proviral latency
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P76542
DIP:
DIP-10042N
ECOCYC:
G7272-MONOMER
ECOLIWIKI:
b2442
ECOO157CYC:
Z5890-MONOMER
ECOO157CYC:
Z1559-MONOMER
ECOO157CYC:
Z1835-MONOMER
ECOO157CYC:
Z1120-MONOMER
ECOO157CYC:
Z0324-MONOMER
ECOO157CYC:
INTL-MONOMER
INTERPRO:
IPR010998
INTERPRO:
IPR044068
INTERPRO:
IPR002104
INTERPRO:
IPR011010
INTERPRO:
IPR038488
INTERPRO:
IPR013762
INTERPRO:
IPR025166
MODBASE:
P76542
PFAM:
PF00589
PFAM:
PF13356
PRIDE:
P76542
PROSITE:
PS51900
PROSITE:
PS51898
REFSEQ:
NP_416937
SMR:
P76542
UNIPROT:
P76542


Operon      
Name: intZ         
Operon arrangement:
Transcription unit        Promoter
intZ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter intZp3 2558693 forward nd [COMP-AINF] [1]


Evidence    

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB