RegulonDB RegulonDB 10.9: Gene Form
   

eutJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

eutE eutH eutG eutJ eutA

Gene      
Name: eutJ    Texpresso search in the literature
Synonym(s): ECK2449, G7284, b2454, yffW
Genome position(nucleotides): 2569501 <-- 2570337 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.66
External database links:  
ASAP:
ABE-0008089
ECHOBASE:
EB3936
ECOLIHUB:
eutJ
OU-MICROARRAY:
b2454
STRING:
511145.b2454
COLOMBOS: eutJ


Product      
Name: putative ethanolamine utilization chaperonin EutJ
Synonym(s): EutJ, YffW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.082
Isoelectric point: 5.143
Motif(s):
 
Type Positions Sequence
141 -> 245 VVDIGGGTTGIAIVKKGKVTYSADEATGGHHISLTLAGNRRISLEEAEQYKRGHGEEIWPAVKPVYEKMADIVARHIEGQGITDLWLAGGSCMQPGVAELFRKQF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0046336 - ethanolamine catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7284-MONOMER
ECOLIWIKI:
b2454
INTERPRO:
IPR043129
INTERPRO:
IPR013366
MODBASE:
P77277
PFAM:
PF14450
PRIDE:
P77277
PRODB:
PRO_000022542
REFSEQ:
NP_416949
SMR:
P77277
UNIPROT:
P77277


Operon      
Name: eutNEJG         
Operon arrangement:
Transcription unit        Promoter
eutNEJG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB