RegulonDB RegulonDB 10.9: Gene Form
   

yfjR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjQ yfjR ypjK

Gene      
Name: yfjR    Texpresso search in the literature
Synonym(s): ECK2630, G7369, b2634
Genome position(nucleotides): 2769703 --> 2770404 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.26
External database links:  
ASAP:
ABE-0008676
ECHOBASE:
EB2996
ECOLIHUB:
yfjR
OU-MICROARRAY:
b2634
STRING:
511145.b2634
COLOMBOS: yfjR


Product      
Name: CP4-57 prophage; putative DNA-binding transcriptional regulator YfjR
Synonym(s): YfjR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.606
Isoelectric point: 8.624
Motif(s):
 
Type Positions Sequence
28 -> 47 LSVRKLAAEFGVSVRTLRRD
14 -> 50 RLSLIISRLVAGETLSVRKLAAEFGVSVRTLRRDFRE
11 -> 73 LAVRLSLIISRLVAGETLSVRKLAAEFGVSVRTLRRDFRERLMYLDLEYQSGYCRLRTAGSEM
129 -> 197 WRLIQAITGRRRVTLIAEGRRCERLAPCRLLIHQQTWYLVAEHEGHIAVFTLDEIHLIQPLQETFRRND

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:1900190 - regulation of single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Herzberg M., et al., 2006
[2] Paradis-Bleau C., et al., 2014
[3] Perez-Rueda E., et al., 2004
External database links:  
ECOCYC:
G7369-MONOMER
ECOLIWIKI:
b2634
INTERPRO:
IPR001034
INTERPRO:
IPR018356
INTERPRO:
IPR026881
PFAM:
PF13280
PFAM:
PF08220
PRIDE:
P52133
PROSITE:
PS00894
PROSITE:
PS51000
REFSEQ:
NP_417123
UNIPROT:
P52133


Operon      
Name: yfjR-ypjK-yfjST         
Operon arrangement:
Transcription unit        Promoter
yfjR-ypjK-yfjS-yfjT


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Herzberg M., Kaye IK., Peti W., Wood TK., 2006, YdgG (TqsA) controls biofilm formation in Escherichia coli K-12 through autoinducer 2 transport., J Bacteriol 188(2):587-98

 [2] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB