RegulonDB RegulonDB 10.9: Gene Form
   

yfjX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjW yfjY yfjX ypjI yfjXp2 yfjXp2

Gene      
Name: yfjX    Texpresso search in the literature
Synonym(s): ECK2639, G7378, b2643
Genome position(nucleotides): 2775919 --> 2776377 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.03
External database links:  
ASAP:
ABE-0008704
ECHOBASE:
EB3002
ECOLIHUB:
yfjX
ECOO157CYC:
Z1656
OU-MICROARRAY:
b2643
STRING:
511145.b2643
COLOMBOS: yfjX


Product      
Name: CP4-57 prophage; putative antirestriction protein YfjX
Synonym(s): YfjX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.303
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
60 -> 152 EYCGGIWSFYTLSNGGAFMAPDADGDDKWHLLNGMNGNGAEMSAEAAGIAVCLIEYSHHACLTECDAMTEHYYRLRDYALQHPESSAIMRIID

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7378-MONOMER
ECOLIWIKI:
b2643
ECOO157CYC:
Z1656-MONOMER
INTERPRO:
IPR004914
INTERPRO:
IPR042297
PFAM:
PF03230
PRIDE:
P52139
REFSEQ:
NP_417130
SMR:
P52139
UNIPROT:
P52139


Operon      
Name: yfjXY-ypjJ-yfjZ-ypjF         
Operon arrangement:
Transcription unit        Promoter
yfjXY-ypjJ-yfjZ-ypjF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfjXp2 2775888 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB