RegulonDB RegulonDB 10.8: Gene Form
   

ygaP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ygaP    Texpresso search in the literature
Synonym(s): ECK2662, G7398, b2668
Genome position(nucleotides): 2797520 --> 2798044 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.9
External database links:  
ASAP:
ABE-0008786
ECHOBASE:
EB3073
OU-MICROARRAY:
b2668
PortEco:
ygaP
STRING:
511145.b2668
COLOMBOS: ygaP


Product      
Name: thiosulfate sulfurtransferase YgaP
Synonym(s): YgaP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 18.639
Isoelectric point: 6.942
Motif(s):
 
Type Positions Sequence
11 -> 14 AQEL
143 -> 168 SGFVGAGLLFAGISGFCGMARLLDKM
43 -> 46 LSVL
2 -> 118 ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQPLPLMRQVQ
20 -> 23 KLID

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004792 - thiosulfate sulfurtransferase activity
GO:0042803 - protein homodimerization activity
External database links:  
ECOCYC:
G7398-MONOMER
ECOLIWIKI:
b2668
INTERPRO:
IPR036873
INTERPRO:
IPR001763
INTERPRO:
IPR021309
MODBASE:
P55734
PDB:
5HBO
PDB:
5HBQ
PDB:
5HPA
PDB:
5LAM
PDB:
5LAO
PDB:
5HBL
PDB:
2MPN
PDB:
2MOL
PDB:
2MOI
PDB:
5HBP
PFAM:
PF11127
PFAM:
PF00581
PRIDE:
P55734
PROSITE:
PS50206
REFSEQ:
NP_417154
SMART:
SM00450
SMR:
P55734
UNIPROT:
P55734


Operon      
Name: ygaVP         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2990 2797266 forward nd [RS-EPT-CBR] [1]



RegulonDB