RegulonDB RegulonDB 10.9: Gene Form
   

ygcP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcQ ygcP ygcO ygcN ygcR

Gene      
Name: ygcP    Texpresso search in the literature
Synonym(s): ECK2763, G7434, b2768
Genome position(nucleotides): 2894196 --> 2894771 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.53
External database links:  
ASAP:
ABE-0009074
ECHOBASE:
EB2924
ECOLIHUB:
ygcP
OU-MICROARRAY:
b2768
STRING:
511145.b2768
COLOMBOS: ygcP


Product      
Name: putative anti-terminator regulatory protein
Synonym(s): YgcP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.786
Isoelectric point: 7.819
Motif(s):
 
Type Positions Sequence
12 -> 184 VIAAVKDNASLQLAIDSECQFISVLYGNICTISNIVKKIKNAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTNTGVW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0001072 - transcription antitermination factor activity, RNA binding
biological_process GO:0006071 - glycerol metabolic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0031564 - transcription antitermination
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12132N
ECOCYC:
G7434-MONOMER
ECOLIWIKI:
b2768
INTERPRO:
IPR006699
INTERPRO:
IPR035928
MODBASE:
Q46906
PANTHER:
PTHR35787
PFAM:
PF04309
PRIDE:
Q46906
REFSEQ:
NP_417248
SMR:
Q46906
UNIPROT:
Q46906


Operon      
Name: ygcNOP         
Operon arrangement:
Transcription unit        Promoter
ygcNOP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB