RegulonDB RegulonDB 10.9: Gene Form
   

ygcQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcS ygcQ ygcR ygcP

Gene      
Name: ygcQ    Texpresso search in the literature
Synonym(s): ECK2764, G7435, b2769
Genome position(nucleotides): 2894919 <-- 2895779 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.63
External database links:  
ASAP:
ABE-0009077
ECHOBASE:
EB2925
ECOLIHUB:
ygcQ
OU-MICROARRAY:
b2769
STRING:
511145.b2769
COLOMBOS: ygcQ


Product      
Name: putative flavoprotein
Synonym(s): YgcQ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 30.308
Isoelectric point: 4.813
Motif(s):
 
Type Positions Sequence
165 -> 244 LAEARRVLVVGQGGEADNQEIAMLAEKLGAEVGYSRARVMNGGVDAEKVIGISGHLLAPEVCIVVGASGAAALMAGVRNS
41 -> 129 AEQVLDALVEQWQRTPADVVLFPPGTFGDELSTRLAWRLHGASICQVTSLDIPTVSVRKSHWGNALTATLQTEKRPLCLSLARQAGAAK
225 -> 253 VCIVVGASGAAALMAGVRNSKFVVAINHD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0009055 - electron transfer activity
GO:0050660 - flavin adenine dinucleotide binding
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7435-MONOMER
ECOLIWIKI:
b2769
INTERPRO:
IPR014730
INTERPRO:
IPR014731
INTERPRO:
IPR014729
INTERPRO:
IPR001308
INTERPRO:
IPR029035
MODBASE:
Q46907
PFAM:
PF00766
PFAM:
PF01012
PRIDE:
Q46907
REFSEQ:
NP_417249
SMR:
Q46907
UNIPROT:
Q46907


Operon      
Name: ygcRQ         
Operon arrangement:
Transcription unit        Promoter
ygcRQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB