RegulonDB RegulonDB 10.9: Gene Form
   

ygcR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygcU ygcS ygcQ ygcR ygcP

Gene      
Name: ygcR    Texpresso search in the literature
Synonym(s): ECK2765, G7436, b2770
Genome position(nucleotides): 2895776 <-- 2896555 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.64
External database links:  
ASAP:
ABE-0009079
ECHOBASE:
EB2926
ECOLIHUB:
ygcR
OU-MICROARRAY:
b2770
STRING:
511145.b2770
COLOMBOS: ygcR


Product      
Name: putative flavoprotein
Synonym(s): YgcR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.72
Isoelectric point: 6.898
Motif(s):
 
Type Positions Sequence
47 -> 214 AAALLLAQRKNGTPMSLTALSMGDERALHWLRYLMALGFEEAVLLETAADLRFAPEFVARHIAEWQHQNPLDLIITGCQSSEGQNGQTPFLLAEMLGWPCFTQVERFTLDALFITLEQRTEHGLRCCRVRLPAVIAVRQCGEVALPVPGMRQRMAAGKAEIIRKTVAA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
biological_process GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7436-MONOMER
ECOLIWIKI:
b2770
INTERPRO:
IPR033948
INTERPRO:
IPR014730
INTERPRO:
IPR014729
INTERPRO:
IPR012255
MODBASE:
Q46908
PANTHER:
PTHR21294
PFAM:
PF01012
PRIDE:
Q46908
REFSEQ:
NP_417250
SMART:
SM00893
SMR:
Q46908
UNIPROT:
Q46908


Operon      
Name: ygcRQ         
Operon arrangement:
Transcription unit        Promoter
ygcRQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB