RegulonDB RegulonDB 10.9: Gene Form
   

ygeG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygeH ygeG ygeF yqeK CysB ygeHp10 ygeHp10 yqeKp12 yqeKp12 yqeKp9 yqeKp9 yqeKp11 yqeKp11

Gene      
Name: ygeG    Texpresso search in the literature
Synonym(s): ECK2849, G7471, b2851
Genome position(nucleotides): 2991268 --> 2991759 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
32.72
External database links:  
ASAP:
ABE-0009364
ECHOBASE:
EB2852
ECOLIHUB:
ygeG
OU-MICROARRAY:
b2851
STRING:
511145.b2851
COLOMBOS: ygeG


Product      
Name: TPR repeat-containing putative chaperone YgeG
Synonym(s): YgeG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.093
Isoelectric point: 4.495
Motif(s):
 
Type Positions Sequence
74 -> 107 HEYLKDFASVCQPKKKYQQAYDLYKLSYNYFPYD
40 -> 73 LDRIYAYAFDYHEKGNITDAEIYYKFLCIYAFEN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12150N
ECOCYC:
G7471-MONOMER
ECOLIWIKI:
b2851
INTERPRO:
IPR005415
INTERPRO:
IPR011716
INTERPRO:
IPR011990
INTERPRO:
IPR016379
PFAM:
PF07720
PRIDE:
Q46787
PRINTS:
PR01595
REFSEQ:
NP_417328
SMR:
Q46787
UNIPROT:
Q46787


Operon      
Name: ygeG         
Operon arrangement:
Transcription unit        Promoter
ygeG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yqeKp11 2990368 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeKp9 2990383 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeKp12 2990570 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB