RegulonDB RegulonDB 10.9: Gene Form
   

insD4 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD4 insD4 ygeO insC4 ygeP ygeN TSS_3142 (cluster) TSS_3142 (cluster)

Gene      
Name: insD4    Texpresso search in the literature
Synonym(s): ECK0358, G7480, b2860, yi22-4
Genome position(nucleotides): 2996372 <-- 2997277 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.08
External database links:  
ASAP:
ABE-0009395
ECOLIHUB:
insD-4
ECOO157CYC:
Z0322
OU-MICROARRAY:
b2860
COLOMBOS: insD4


Product      
Name: IS2 insertion element protein InsB
Synonym(s): InsD4
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 34.398
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
106 -> 289 KPAVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRA
61 -> 104 GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
124 -> 227 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSP

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4448
INTERPRO:
IPR012337
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR001584
PFAM:
PF13276
PFAM:
PF00665
PRIDE:
P0CF56
PROSITE:
PS50994
REFSEQ:
NP_417337
UNIPROT:
P0CF56


Operon      
Name: insCD4C4D4-ygeON         
Operon arrangement:
Transcription unit        Promoter
insC4D4CD4-ygeON


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3142 (cluster) 2997629 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB