RegulonDB RegulonDB 10.9: Gene Form
   

mocA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygfK yqeC mocA ssnAp ssnAp ygfKp ygfKp yqeCp5 yqeCp5 yqeCp7 yqeCp7 mocAp9 mocAp9

Gene      
Name: mocA    Texpresso search in the literature
Synonym(s): ECK2873, G7496, b2877, ygfJ
Genome position(nucleotides): 3015160 --> 3015738 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.18
External database links:  
ASAP:
ABE-0009447
ECHOBASE:
EB2872
ECOLIHUB:
mocA
OU-MICROARRAY:
b2877
STRING:
511145.b2877
COLOMBOS: mocA


Product      
Name: molybdenum cofactor cytidylyltransferase
Synonym(s): MocA, YgfJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 21.514
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
6 -> 143 CIITAAGLSSRMGQWKMMLPWEQGTILDTSIKNALQFCSRIILVTGYRGNELHERYANQSNITIIHNPDYAQGLLTSVKAAVPAVQTEHCFLTHGDMPTLTIDIFRKIWSLRNDGAILPLHNGIPGHPILVSKPCLMQ
79 -> 82 LLTS
9 -> 11 TAA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0000287 - magnesium ion binding
GO:0061602 - molybdenum cofactor cytidylyltransferase activity
biological_process GO:0006777 - Mo-molybdopterin cofactor biosynthetic process
GO:1902760 - Mo(VI)-molybdopterin cytosine dinucleotide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7496-MONOMER
ECOLIWIKI:
b2877
INTERPRO:
IPR017696
INTERPRO:
IPR025877
INTERPRO:
IPR029044
MODBASE:
Q46810
PFAM:
PF12804
PRIDE:
Q46810
REFSEQ:
NP_417353
SMR:
Q46810
UNIPROT:
Q46810


Operon      
Name: mocA         
Operon arrangement:
Transcription unit        Promoter
mocA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mocAp9 3015056 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeCp7 3015167 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yqeCp5 3015234 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB