RegulonDB RegulonDB 10.10: Gene Form
   

yghU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gss yghU hybG TSS_3305 TSS_3305 yghUp yghUp gssp gssp

Gene      
Name: yghU    Texpresso search in the literature
Synonym(s): ECK2983, G7553, b2989
Genome position(nucleotides): 3138727 --> 3139593 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.4
External database links:  
ASAP:
ABE-0009812
ECHOBASE:
EB2827
ECOLIHUB:
yghU
OU-MICROARRAY:
b2989
STRING:
511145.b2989
COLOMBOS: yghU


Product      
Name: disulfide reductase / organic hydroperoxide reductase
Synonym(s): GST N2-2, YghU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.392
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
52 -> 54 TPN
65 -> 127 LLALGVTGAEYDAWLIRIGDGDQFSSGFVEVNPNSKIPALRDHTHNPPIRVFESGSILLYLAE
174 -> 244 YAINRFTMEAKRLLDVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLGGVYDAAEFLDAGSYKHVQRWAK
117 -> 118 ES
139 -> 265 KRTETMNWLFWLQGAAPFLGGGFGHFYHYAPVKIEYAINRFTMEAKRLLDVLDKQLAQHKFVAGDEYTIADMAIWPWFGNVVLGGVYDAAEFLDAGSYKHVQRWAKEVGERPAVKRGRIVNRTNGPL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0015036 - disulfide oxidoreductase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006749 - glutathione metabolic process
GO:0098869 - cellular oxidant detoxification
External database links:  
DIP:
DIP-12212N
ECOCYC:
G7553-MONOMER
ECOLIWIKI:
b2989
INTERPRO:
IPR040079
INTERPRO:
IPR036282
INTERPRO:
IPR036249
INTERPRO:
IPR010987
INTERPRO:
IPR004045
MODBASE:
Q46845
PDB:
3C8E
PFAM:
PF02798
PFAM:
PF13410
PRIDE:
Q46845
PROSITE:
PS50404
PROSITE:
PS50405
REFSEQ:
NP_417463
SMR:
Q46845
UNIPROT:
Q46845


Operon      
Name: yghU         
Operon arrangement:
Transcription unit        Promoter
yghU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3305 3138702 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB