RegulonDB RegulonDB 10.9: Gene Form
   

hybO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hybO hybA yghW hybB NarL ArcA NarL NarL TSS_3313 TSS_3313 hybOp1 hybOp1 TSS_3311 TSS_3311 TSS_3310 TSS_3310 TSS_3309 (cluster) TSS_3309 (cluster) TSS_3308 TSS_3308 TSS_3307 TSS_3307

Gene      
Name: hybO    Texpresso search in the literature
Synonym(s): ECK2991, G7554, b2997, yghV
Genome position(nucleotides): 3145143 <-- 3146261 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.33
External database links:  
ASAP:
ABE-0009834
ECHOBASE:
EB2828
ECOLIHUB:
hybO
OU-MICROARRAY:
b2997
STRING:
511145.b2997
COLOMBOS: hybO


Product      
Name: hydrogenase 2 small subunit
Synonym(s): HybO, YghV, hydrogenase 2 subunit beta;
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 39.652
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
334 -> 356 AGAIGLLGGVVGLVAGVSVMAVR
1 -> 37 MTGDNTLIHSHGINRRDFMKLCAALAATMGLSSKAAA
38 -> 372 EMAESVTNPQRPPVIWIGAQECTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVLPGKTVINIPGCPPNPHNFLATVAHIITYGKPPKLDDKNRPTFAYGRLIHEHCERRPHFDAGRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGIGFHKGIHQLANVENQTPRSQKPDVNAKEGGNVSAGAIGLLGGVVGLVAGVSVMAVRELGRQQKKDNADSRGE
224 -> 302 YGRLIHEHCERRPHFDAGRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGIGF
59 -> 204 CTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVLPGKTVINIPGCPPNPHNFLATVAH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0042597 - periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0009375 - ferredoxin hydrogenase complex
GO:0031236 - extrinsic component of periplasmic side of plasma membrane
GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008901 - ferredoxin hydrogenase activity
GO:0051538 - 3 iron, 4 sulfur cluster binding
GO:0033748 - hydrogenase (acceptor) activity
biological_process GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-36024N
ECOCYC:
MONOMER0-145
ECOLIWIKI:
b2997
INTERPRO:
IPR037148
INTERPRO:
IPR037024
INTERPRO:
IPR027394
INTERPRO:
IPR019546
INTERPRO:
IPR006311
INTERPRO:
IPR006137
INTERPRO:
IPR001821
MINT:
P69741
MODBASE:
P69741
PANTHER:
PTHR30013
PDB:
6EHS
PDB:
6GAM
PDB:
6GAN
PDB:
6G7M
PDB:
6EN9
PDB:
6EHQ
PFAM:
PF01058
PFAM:
PF14720
PRIDE:
P69741
PRODB:
PRO_000022953
PROSITE:
PS51318
REFSEQ:
NP_417471
SMR:
P69741
SWISSMODEL:
P69741
UNIPROT:
P69741


Operon      
Name: hybOABCDEFG         
Operon arrangement:
Transcription unit        Promoter
hybOABCDEFG


Transcriptional Regulation      
Display Regulation             
Repressed by: NarL, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3307 3144533 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3308 3145033 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3309 (cluster) 3145041 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3310 3146287 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3311 3146356 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3313 3146405 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB