RegulonDB RegulonDB 10.10: Gene Form
   

yghW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yghW    Texpresso search in the literature
Synonym(s): ECK2992, G7555, b2998
Genome position(nucleotides): 3146450 <-- 3146737 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.49
External database links:  
ASAP:
ABE-0009839
ECHOBASE:
EB2829
ECOLIHUB:
yghW
OU-MICROARRAY:
b2998
STRING:
511145.b2998
COLOMBOS: yghW


Product      
Name: DUF2623 domain-containing protein YghW
Synonym(s): YghW
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.945
Isoelectric point: 9.502
Motif(s):
 
Type Positions Sequence
1 -> 92 MNNHFGKGLMAGLKATHADSAVNVTKFCADYKRGFVLGYSHRMYEKTGDRQLSAWEAGILTRRYGLDKEMVMDFFRENNSCSTLRFFMAGYR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:1901422 - response to butan-1-ol
Note(s): Note(s): ...[more].
Reference(s): [1] Kurata T., et al., 2013
[2] Shuster Y., et al., 2016
External database links:  
DIP:
DIP-35982N
ECOCYC:
G7555-MONOMER
ECOLIWIKI:
b2998
INTERPRO:
IPR022574
PFAM:
PF11115
PRIDE:
P64574
REFSEQ:
NP_417472
UNIPROT:
P64574


Operon      
Name: yghW         
Operon arrangement:
Transcription unit        Promoter
yghW


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3310 3146287 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3311 3146356 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3313 3146405 reverse nd [RS-EPT-CBR] [3]
  promoter yghWp6 3146753 reverse nd [ICWHO] [4]



RegulonDB