RegulonDB RegulonDB 10.9: Gene Form
   

yghW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hybO yghX yghW yqhI NarL ArcA NarL NarL terminator yghWp6 yghWp6 TSS_3313 TSS_3313 hybOp1 hybOp1 TSS_3311 TSS_3311 TSS_3310 TSS_3310

Gene      
Name: yghW    Texpresso search in the literature
Synonym(s): ECK2992, G7555, b2998
Genome position(nucleotides): 3146450 <-- 3146737 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.49
External database links:  
ASAP:
ABE-0009839
ECHOBASE:
EB2829
ECOLIHUB:
yghW
OU-MICROARRAY:
b2998
STRING:
511145.b2998
COLOMBOS: yghW


Product      
Name: DUF2623 domain-containing protein YghW
Synonym(s): YghW
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.945
Isoelectric point: 9.502
Motif(s):
 
Type Positions Sequence
1 -> 92 MNNHFGKGLMAGLKATHADSAVNVTKFCADYKRGFVLGYSHRMYEKTGDRQLSAWEAGILTRRYGLDKEMVMDFFRENNSCSTLRFFMAGYR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
biological_process GO:1901422 - response to butan-1-ol
Note(s): Note(s): ...[more].
Reference(s): [1] Kurata T., et al., 2013
[2] Shuster Y., et al., 2016
External database links:  
DIP:
DIP-35982N
ECOCYC:
G7555-MONOMER
ECOLIWIKI:
b2998
INTERPRO:
IPR022574
PFAM:
PF11115
PRIDE:
P64574
REFSEQ:
NP_417472
UNIPROT:
P64574


Operon      
Name: yghW         
Operon arrangement:
Transcription unit        Promoter
yghW


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3310 3146287 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3311 3146356 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3313 3146405 reverse nd [RS-EPT-CBR] [3]
  promoter yghWp6 3146753 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kurata T., Katayama A., Hiramatsu M., Kiguchi Y., Takeuchi M., Watanabe T., Ogasawara H., Ishihama A., Yamamoto K., 2013, Identification of the set of genes, including nonannotated morA, under the direct control of ModE in Escherichia coli., J Bacteriol 195(19):4496-505

 [2] Shuster Y., Steiner-Mordoch S., Alon Cudkowicz N., Schuldiner S., 2016, A Transporter Interactome Is Essential for the Acquisition of Antimicrobial Resistance to Antibiotics., PLoS One 11(4):e0152917

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB