RegulonDB RegulonDB 10.10: Gene Form
   

yqiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

parE cpdA yqiA yqiB TSS_3332 TSS_3332 TSS_3331 TSS_3331 TSS_3330 TSS_3330 TSS_3329 TSS_3329

Gene      
Name: yqiA    Texpresso search in the literature
Synonym(s): ECK3022, G7578, b3031, yzzI
Genome position(nucleotides): 3175425 <-- 3176006 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.78
External database links:  
ASAP:
ABE-0009953
ECHOBASE:
EB2103
ECOLIHUB:
yqiA
OU-MICROARRAY:
b3031
STRING:
511145.b3031
COLOMBOS: yqiA


Product      
Name: esterase YqiA
Synonym(s): YqiA, YzzI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.641
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
4 -> 188 LLYLHGFNSSPRSAKASLLKNWLAEHHPDVEMIIPQLPPYPSDAAELLESIVLEHGGDSLGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLTDYLGQNENPYTGQQYVLESRHIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVIEGGNHAFTGFEDYFNPIVDFL
135 -> 137 APD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.1 - radiation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0016787 - hydrolase activity
GO:0052689 - carboxylic ester hydrolase activity
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Kuznetsova E., et al., 2005
External database links:  
ECOCYC:
G7578-MONOMER
ECOLIWIKI:
b3031
INTERPRO:
IPR029058
INTERPRO:
IPR008886
MODBASE:
P0A8Z7
PANTHER:
PTHR35602
PFAM:
PF05728
PRIDE:
P0A8Z7
REFSEQ:
NP_417503
SMR:
P0A8Z7
UNIPROT:
P0A8Z7


Operon      
Name: nudF-yqiB-cpdA-yqiA-parE         
Operon arrangement:
Transcription unit        Promoter
nudF-yqiB-cpdA-yqiA-parE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3329 3174907 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3330 3175645 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3331 3176921 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3332 3176965 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB